1,723,472 research outputs found
Pegawéan ‘Job’
No full textThis is a recording of two men, Deni and Riyan at Rusnan's house. Deni is 25 years old, born and grew up in Pondok Prasi, married to a woman from west Lombok. He finished elementary school. Riyan is 25 years old, born and grew up in Pondok Prasi, married to a woman from a village in west Lombok which is still a neighboring village. Speakers are childhood friends and both are fishermen. He finished middle school. They are talking about financial issues and work. The recording ends with Khairunnisa collecting metadata from the speakers. Muhammad Jaelani assisted with the recording. Video was recorded on Panasonic HC-V770, audio on Marantz PMD561 with an Audio Technica AT8022 Stereo Microphone.Ampenan, Lombok, West Nusa Tenggara province, Indonesi
SOSIALISASI BUDIDAYA MAGGOT DI UPR RIYAN DESA SEI SILAU TIMUR KECAMATAN BUNTU PANE
No full textPakan yang diberikan pada ikan di Unit Pembenihan Rakyat (UPR) RIYAN belum memenuhi syarat tepat mutu/kualitas, tepat jumlah/kuantitas, tepat waktu dan berkesinambungan. Pakan larva ikan dan benih di UPR RIYAN masih mengandalkan stok pakan di pasar. Pemenuhan pakan dari pasar meningkatkan biaya operasional dari UPR selain itu adanya kelangkaan stok pakan di pasar berdampak buruk terhadap ikan yang dipelihara bahkan dapat menyebabkan kematian benih ikan,keadaan ini menyebabkan kemampuan UPR RIYAN dalam memenuhi kebutuhan pasar akan benih ikan berkurang. Pemenuhan akan pakan dapat dilakukan dengan melakukan usaha budidaya pakan alami seperti maggot. Maggot merupakan pakan alami memiliki kandungan protein yang tinggi sehingga dapat mendukung pertumbuhan dan kelulushidupan ikan yang dibudidayakan. Rendahnya atau belum adanya pengetahuan UPR RIYAN dalam melakukan usaha budidaya maggot dan adanya limbah lumpur kelapa sawit (solid) disekitar lokasi UPR yang dapat dimanfaatkan sebagai media tumbuh maka dipandang perlu melakukan kegiatan Program Kemitraan Masyarakat (PKM) untuk memberikan solusi dari permasalahan yang dihadapi oleh UPR RIYAN
Marketing Communication Strategy Of Riyan Farm Hydroponic Vegetable (Case Of Riyan Farm Smes, Serang City)
Full text linkRiyan Farm is one of agricultural business that uses hydroponic method to grow vegetables in Serang City. However, many people of Serang City and the county around are still not knowing Riyan Farm’s hydroponic product which results in decreased sales. This requires Riyan Farm to determind the right marketing communication strategy. This study lasted for 7 months with several considerations. The research took place on RSS Pemda Housing Block D1 Banjarsari District Cipocok Jaya Serang City Banten. This research uses a benchmarking approach against other business that have similar products and have been successful in the market. Benchmarking method performed by collecting information from other Farm’s product through in-depth interviews and observation and other data that have reliable information as books and literature. The analysis tools used are Gap analysis, IFE matrix, EFE matrix and SWOT matrix. The Gap analysis based on marketing communication mix results in 7 recommendation of communication strategy. In order to create the applicative strategy that suits company’s environment, those 7 recommendations should be combined with the result of SWOT Analysis. The last of result shows 5 market communication alternative strategy
Riyan Bimantoro's Quick Files
No full textThe Quick Files feature was discontinued and it’s files were migrated into this Project on March 11, 2022. The file URL’s will still resolve properly, and the Quick Files logs are available in the Project’s Recent Activity
Riyan Bimantoro's Quick Files
No full textThe Quick Files feature was discontinued and it’s files were migrated into this Project on March 11, 2022. The file URL’s will still resolve properly, and the Quick Files logs are available in the Project’s Recent Activity
template ecommerce riyan
No full textHTMLadalahsebuahbahasapemprogramanyangdigunakanuntuk
membuatsebuahhalamanwebsitedanmenampilkanberbagaiinformasi
yangterdapatdalamsebuahbrowserinternet
Tag–taghtml
sebagaitandaawaldokumenhtml
sebagaiinformasipagehader
sebagaititleataujudulhalaman
sebagaiisidarisebuahhalamanwebsite
Tag-tagnya
kalimatyangterletakpadatagkontinerinitidakakanterlihatpada
browser
membuatlinkhalamanlainataukebagianlaindarihalaman
tersebut
membuatnamabagianyangdidefinisikanpadalinkpadahalaman
yangsama
sebagaiawaldarijavaaplet
yangdapatdiklik(link)padaimagemap
membuattekstebalmembuatatributteks
defaultsepertijenisukurandanwarnafontmemberi(suaralatar
Riyan Bimantoro's Quick Files
No full textThe Quick Files feature was discontinued and it’s files were migrated into this Project on March 11, 2022. The file URL’s will still resolve properly, and the Quick Files logs are available in the Project’s Recent Activity
- …
