1,721,117 research outputs found
Neuromuscular Activity Of Batx, A Presynaptic Basic Pla2 Isolated From Bothrops Alternatus Snake Venom
No full textWe have previously isolated a Lys49 phospholipase A2 homolog (BaTX) from Bothrops alternatus snake venom using a combination of molecular exclusion chromatography and reverse phase HPLC and shown its ability to cause neuromuscular blockade. In this work, we describe a one-step procedure for the purification of this toxin and provide further details of its neuromuscular activity. The toxin was purified by reverse phase HPLC and its purity and molecular mass were confirmed by SDS-PAGE, MALDI-TOF mass spectrometry, amino acid analysis and N-terminal sequencing. BaTX (0.007-1.4 μM) produced time-dependent, irreversible neuromuscular blockade in isolated mouse phrenic nerve-diaphragm and chick biventer cervicis preparations (time to 50% blockade with 0.35 μM toxin: 58 ± 4 and 24 ± 1 min, respectively; n = 3-8; mean ± S.E.) without significantly affecting the response to direct muscle stimulation. In chick preparations, contractures to exogenous acetylcholine (55 and 110 μM) or KCl (13.4 mM) were unaltered after complete blockade by all toxin concentrations. These results, which strongly suggested a presynaptic mechanism of action for this toxin, were reinforced by (1) the inability of BaTX to interfere with the carbachol-induced depolarization of the resting membrane, (2) a significant decrease in the frequency and amplitude of miniature end-plate potentials, and (3) a significant reduction (59 ± 4%, n = 12) in the quantal content of the end-plate potentials after a 60 min incubation with the toxin (1.4 μM). In addition, a decrease in the organ bath temperature from 37 °C to 24 °C and/or the replacement of calcium with strontium prevented the neuromuscular blockade, indicating a temperature-dependent effect possibly mediated by enzymatic activity. © 2009 Elsevier Inc. All rights reserved.1502291297Abreu, V.A., Dal Belo, C.A., Hernandes-Oliveira, S.S., Borja-Oliveira, C.R., Hyslop, S., Furtado, M.F., Rodrigues-Simioni, L., Neuromuscular and phospholipase activities of venoms from three subspecies of Bothrops neuwiedi (B. n. goyazensis, B. n. paranaensis and B. n. diporus) (2007) Comp. Biochem. Physiol. A Mol. Integr. Physiol., 148, pp. 142-149Acosta de Pérez, O., Koscinczuk, P., Negrette, S., Sánchez Negrette, M., Teibler, P., Ruiz, R., Efectos del veneno de Bothrops alternatus de Argentina sobre músculo y distintos organos de ratones (1996) Acta Physiol. Pharmacol. Ther. Latinoam., 46, pp. 97-102Borja-Oliveira, C.R., Durigon, A.M., Vallin, A.C., Toyama, M.H., Souccar, C., Marangoni, S., Rodrigues-Simioni, L., The pharmacological effect of Bothrops neuwiedii pauloensis (jararaca-pintada) snake venom on avian neuromuscular transmission (2003) Braz. J. Med. Biol. Res., 36, pp. 617-624Borja-Oliveira, C.R., Kassab, B.H., Soares, A.M., Toyama, M.H., Giglio, J.R., Marangoni, S., Re, L., Rodrigues-Simioni, L., Purification and N-terminal sequencing of two presynaptic neurotoxic PLA2, neuwieditoxin-I and neuwieditoxin-II, from Bothrops neuwiedi pauloensis (jararaca pintada) venom (2007) J. Venom. Anim. Toxins incl. Trop. Dis., 13, pp. 103-121Bülbring, E., Observations on the isolated phrenic nerve diaphragm preparation of the rat (1946) Br. J. Pharmacol., 1, pp. 38-61Chang, C.C., Neurotoxins with phospholipase A2 activity in snake venoms (1985) Proc. Natl. Sci. Counc. Repub. China [B], 9, pp. 126-142Chang, C.C., Chen, T.F., Lee, C.Y., Studies of the presynaptic effect of β-bungarotoxin on neuromuscular transmission (1973) J. Pharmacol. Exp. Ther., 184, pp. 339-345Cintra, A.C., Marangoni, S., Oliveira, B., Giglio, J.R., Bothropstoxin-I: amino acid sequence and function (1993) J. Protein Chem., 12, pp. 57-64Cogo, J.C., Prado-Franceschi, J., Cruz-Höfling, M.A., Corrado, A.P., Rodrigues-Simioni, L., Effect of Bothrops insularis venom on the mouse and chick nerve-muscle preparation (1993) Toxicon, 31, pp. 1237-1247Cogo, J.C., Prado-Franceschi, J., Giglio, J.R., Corrado, A.P., Cruz-Höfling, M.A., Donato, J.L., Leite, G.B., Rodrigues-Simioni, L., An unusual presynaptic action of Bothrops insularis snake venom mediated by phospholipase A2 fraction (1998) Toxicon, 36, pp. 1323-1332Cogo, J.C., Lilla, S., Souza, G.H., Hyslop, S., de Nucci, G., Purification, sequencing and structural analysis of two acidic phospholipases A2 from the venom of Bothrops insularis (jararaca ilhoa) (2006) Biochimie, 88, pp. 1947-1959Costa, P.D., Toyama, M.H., Marangoni, S., Rodrigues-Simioni, L., Cruz-Höfling, M.A., Effects of Bothrops pirajai venom on the mouse extensor digitorum longus (EDL) muscle preparation (1999) Toxicon, 37, pp. 1143-1153Dal Belo, C.A., Leite, G.B., Toyama, M.H., Marangoni, S., Corrado, A.P., Fontana, M.D., Southan, A., Rodrigues-Simioni, L., Pharmacological and structural characterization of a novel phospholipase A2 from Micrurus dumerilii carinicauda venom (2005) Toxicon, 46, pp. 736-750de Roodt, A.R., Dolab, J.A., Dokmetjian, J.C., Litwin, S., Segre, L., Vidal, J.C., A comparison of different methods to assess the hemorrhagic activity of Bothrops venoms (2000) Toxicon, 38, pp. 865-873de Roodt, A.R., Litwin, S., Vidal, J.C., Hemorrhagic activity of Bothrops venoms determined by two different methods and relationship with proteolytic activity on gelatin and lethality (2003) Toxicon, 41, pp. 949-958Elmqvist, D., Quastel, D.M.J., Presynaptic action of hemicholinium at the neuromuscular junction (1965) J. Physiol., 177, pp. 463-482Gay, C.C., Leiva, L.C., Maruñak, S., Teibler, P., Acosta de Pérez, O., Proteolytic, edematogenic and myotoxic activities of a hemorrhagic metalloproteinase isolated from Bothrops alternatus venom (2005) Toxicon, 46, pp. 546-554Ginsborg, B.L., Warriner, J., The isolated chick biventer cervicis nerve-muscle preparation (1960) Br. J. Pharm. Chemother., 15, pp. 410-411Gutiérrez, J.M., Lomonte, B., Efectos locales en el envenenamiento ofídico en América Latina (2003) Animais Peçonhentos no Brasil: Biologia, Clínica e Terapêutica dos Acidentes, pp. 310-323. , Cardoso J.L.C., França F.O.S., Wen F.H., Málaque C.M.S., and Haddad Jr. V. (Eds), Sarvier/FAPESP, São PauloGutiérrez, J.M., Ownby, C.L., Skeletal muscle degeneration induced by venom phospholipases A2: insights into the mechanisms of local and systemic myotoxicity (2003) Toxicon, 15, pp. 915-931Gutiérrez, J.M., Rucavado, A., Snake venom metalloproteinases: their role in the pathogenesis of local tissue damage (2000) Biochimie, 82, pp. 841-850Gutiérrez, J.M., Rucavado, A., Escalante, T., Díaz, C., Hemorrhage induced by snake venom metalloproteinases: biochemical and biophysical mechanisms involved in microvessel damage (2005) Toxicon, 45, pp. 997-1011Hawgood, B.J., Smith, J., The presynaptic action of crotoxin at the murine neuromuscular junction [proceedings] (1977) J. Physiol., 266, pp. 91P-92PHawgood, B.J., Smith, I.C., The importance of phospholipase A2 in the early induction by crotoxin of biphasic changes in endplate potentials at the frog neuromuscular junction (1989) Toxicon, 27, pp. 272-276Hawgood, B.J., Smith, I.C., Strong, P.N., Early induction by crotoxin of biphasic frequency changes and giant miniature endplate potentials in frog muscle (1988) Br. J. Pharmacol., 94, pp. 765-772Homsi-Brandeburgo, M.I., Queiroz, L.S., Santo-Neto, H., Rodrigues-Simioni, L., Giglio, J.R., Fractionation of Bothrops jararacussu snake venom: partial chemical characterization and biological activity of bothropstoxin (1988) Toxicon, 26, pp. 615-627Kini, R.M., Excitement ahead: structure, function and mechanism of snake venom phospholipase A2 enzymes (2003) Toxicon, 42, pp. 827-840Lomonte, B., Ângulo, Y., Calderón, L., An overview of lysine-49 phospholipase A2 myotoxins from crotalid snake venoms and their structural determinants of myotoxic action (2003) Toxicon, 42, pp. 885-901Maruñak, S.L., Acosta de Pérez, O., Ruíz de Torrent, R.M., Teibler, G.P., Koscinczuk, P., Sánchez Negrette, M., Actividades hemorrágica, edematizante, proteolítica y mionecrótica de venenos de Bothrops alternatus (víbora de la Cruz) (1999) Acta Physiol. Pharmacol. Ther. Latinoam., 49, pp. 149-154Nisenbom, H.E., Perazzo, J.C., Monserrat, A.J., Vidal, J.C., Contribution of phospholipase A2 to the lethal potency of Bothrops alternatus (vibora de la cruz) venom (1986) Toxicon, 24, pp. 807-817Nisenbom, H.E., Seki, C., Vidal, J.C., Phospholipase A2 from Bothrops alternatus (vibora de la cruz) venom. Purification and some characteristic properties (1986) Toxicon, 24, pp. 259-272Nisenbom, H.E., Perazzo, J.C., Monserrat, A.J., Vidal, J.C., Effect of chemical modification with p-bromophenacyl bromide on the enzymatic and lethal properties of phospholipase A2 from Bothrops alternatus (vibora de la cruz) venom (1988) Toxicon, 26, pp. 1137-1144Oberg, S.G., Kelly, R.B., The mechanism of beta-bungarotoxin action. I. Modification of transmitter release at the neuromuscular junction (1976) J. Neurobiol., 7, pp. 129-141Oshima-Franco, Y., Leite, G.B., Belo, C.A., Hyslop, S., Prado-Franceschi, J., Cintra, A.C., Giglio, J.R., Rodrigues-Simioni, L., The presynaptic activity of bothropstoxin-I, a myotoxin from Bothrops jararacussu snake venom (2004) Basic Clin. Pharmacol. Toxicol., 95, pp. 175-182Ponce-Soto, L.A., Bonfim, V.L., Rodrigues-Simioni, L., Novello, J.C., Marangoni, S., Determination of primary structure of two isoforms 6-1 and 6-2 PLA2 D49 from Bothrops jararacussu snake venom and neurotoxic characterization using in vitro neuromuscular preparation (2006) Protein J., 25, pp. 147-155Ponce-Soto, L.A., Lomonte, B., Gutiérrez, J.M., Rodrigues-Simioni, L., Novello, J.C., Marangoni, S., Structural and functional properties of BaTX, a new Lys49 phospholipase A2 homologue isolated from the venom of the snake Bothrops alternatus (2007) Biochim. Biophys. Acta, 1770, pp. 585-593Prianti Jr., A.C., Ribeiro, W., Lopes-Martins, R.A., Lira-Da-Silva, R.M., Prado-Franceschi, J., Rodrigues-Simioni, L., Cruz-Höfling, M.A., Cogo, J.C., Effect of Bothrops leucurus venom in chick biventer cervicis preparations (2003) Toxicon, 41, pp. 595-603Prior, C., Dempster, J., Marshall, G., Electrophysiological analysis of transmission at the skeletal neuromuscular junction (1993) J. Pharmacol. Toxicol. Methods, 30, pp. 1-17Rodrigues-Simioni, L., Borgese, N., Ceccarelli, B., The effects of Bothrops jararacussu venom and its components on frog nerve-muscle preparation (1983) Neuroscience, 10, pp. 475-489Rodrigues-Simioni, L., Hawgood, B.J., Smith, I.C., Properties of the early phases of crotoxin poisoning at frog neuromuscular junctions (1990) Toxicon, 28, pp. 1479-1489Rodrigues-Simioni, L., Zamunér, S.R., Cogo, J.C., Borja-Oliveira, C.R., Prado-Franceschi, J., Cruz-Höfling, M.A., Corrado, A.P., Pharmacological evidence for a presynaptic action of venoms from Bothrops insularis (jararaca ilhoa) and Bothrops neuwiedi (jararaca pintada) (2004) Toxicon, 43, pp. 633-638Sanchez, E.F., Freitas, T.V., Ferreira-Alves, D.L., Velarde, D.T., Diniz, M.R., Cordeiro, M.N., Agostini-Cotta, G., Diniz, C.R., Biological activities of venoms from South American snakes (1992) Toxicon, 30, pp. 95-103Soares, A.M., Guerra-Sá, R., Borja-Oliveira, C.R., Rodrigues, V.M., Rodrigues-Simioni, L., Rodrigues, V., Fontes, M.R., Giglio, J.R., Structural and functional characterization of BnSP-7, a Lys49 myotoxic phospholipase A2 homologue from Bothrops neuwiedi pauloensis venom (2000) Arch. Biochem. Biophys., 378, pp. 201-209Soares, A.M., Andrião-Escarso, S.H., Bortoleto, R.K., Rodrigues-Simioni, L., Arni, R.K., Ward, R.J., Gutiérrez, J.M., Giglio, J.R., Dissociation of enzymatic and pharmacological properties of piratoxins-I and -III, two myotoxic phospholipases A2 from Bothrops pirajai snake venom (2001) Arch. Biochem. Biophys., 387, pp. 188-196Teixeira, C.F., Landucci, E.C., Antunes, E., Chacur, M., Cury, Y., Inflammatory effects of snake venom myotoxic phospholipases A2 (2003) Toxicon, 42, pp. 947-962Van der Kloot, W., Nicotinic agonists antagonize quantal size increases and evoked release at frog neuromuscular junction (1993) J. Physiol., 468, pp. 567-589Veldesema-Currie, R.D., Van Wilgenburg, H., Labruyère, W.T., Langermeijer, M.W.E., Presynaptic facilitatory effects of the corticosteroid dexamethasone in rat diaphragm: modulation by beta-bungarotoxin (1984) Brain Res., 294, pp. 315-325Zamunér, S.R., Cruz-Höfling, M.A., Corrado, A.P., Hyslop, S., Rodrigues-Simioni, L., Comparison of the neurotoxic and myotoxic effects of Brazilian Bothrops venoms and their neutralization by commercial antivenom (2004) Toxicon, 44, pp. 259-27
Positive inotropic effects of Tityus cambridgei and Tityus serrulatus scorpion venoms on skeletal muscle
No full textPurification And N-terminal Sequencing Of Two Presynaptic Neurotoxic Pla2, Neuwieditoxin-i And Neuwieditoxin-ii, From Bothrops Neuwiedi Pauloensis (jararaca Pintada) Venom
Full text linkTwo presynaptic phospholipases A2 (PLA2), neuwieditoxin-I (NeuTX-I) and neuwieditoxin-II (NeuTX-II), were isolated from the venom of Bothrops neuwiedi pauloensis (BNP). The venom was fractionated using molecular exclusion HPLC (Protein-Pak 300SW column), followed by reverse phase HPLC (μBondapak C18 column). Tricine-SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX-I and NeuTX-II had a molecular mass of approximately 14 kDa and 28kDa, respectively. At 10μg/ml, both toxins produced complete neuromuscular blockade in indirectly stimulated chick biventer cervicis isolated preparation without inhibiting the response to acetylcholine, but NeuTX-II reduced the response to KCl by 67.0±8.0% (n=3; p<0.05). NeuTX-I and NeuTX-II are probably responsible for the presynaptic neurotoxicity of BNP venom in vitro. In fact, using loose patch clamp technique for mouse phrenic nerve-diaphragm preparation, NeuTX-I produced a calcium-dependent blockade of acetylcholine release and caused appearance of giant miniature end-plate potentials (mepps), indicating a pure presynaptic action. The N-terminal sequence of NeuTX-I was DLVQFGQMILKVAGRSLPKSYGAYGCYCGWGGRGK (71% homology with bothropstoxin-II and 54% homology with caudoxin) and that of NeuTX-II was SLFEFAKMILEETKRLPFPYYGAYGCYCGWGGQGQPKDAT (92% homology with Basp-III and 62% homology with crotoxin PLA2). The fact that NeuTX-I has Q-4 (Gln-4) and both toxins have F-5 (Phe-5) and Y-28 (Tyr-28) strongly suggests that NeuTX-I and NeuTX-II are Asp49 PLA2.131103121AIRD, S.D., KAISER II, LEWIS RV., KRUGGEL WG. A complete amino acid sequence for the basic subunit of crotoxin (1986) Arch. Biochem. Biophys, 249, pp. 296-300AIRD, S.D., KRUGGEL, W.G., KAISER II, Amino acid sequence of the basic subunit of Mojave toxin from the venom of the Mojave rattlesnake (Crotalus s. scutulatus) (1990) Toxicon, 28, pp. 669-673BEGHINI, D.G., TOYAMA, M.H., HYSLOP, S., SODEK, L., NOVELLO, J.C., MARANGONI, S., Enzymatic characterization of a novel phospholipase A2 from Crotalus durissus cascavella rattlesnake (maracambóia) venom (2000) J. Protein Chem, 19, pp. 603-607BORJA-OLIVEIRA, C.R., DURIGON, A.M., VALLIN, A.C.C., TOYAMA, M.H., SOUCCAR, C., MARANGONI, S., RODRIGUES-SIMIONI, L., The pharmacological effects of Bothrops neuwiedi pauloensis (jararaca-pintada) snake venom on avian neuromuscular transmission (2003) Braz. J. Med. Biol. Res, 36, pp. 617-624BORJA-OLIVEIRA, C.R., SOARES, A.M., ZAMUNER, S.R., HYSLOP, S., GIGLIO, J.R., PRADO-FRANCESCHI, J., RODRIGUES-SIMIONI, L., Intraspecific variation in the neurotoxic and myotoxic activities of Bothrops neuwiedi snake venoms (2002) J. Venom. Anim. Toxins, 8, pp. 88-101BUCARETCHI, F., HERRERA, S.R.F., HYSLOP, S., BARACAT, E.C.E., VIEIRA, R.J., Snakebites by Bothrops spp in children in Campinas, São Paulo, Brazil (2001) Rev. Inst. Med. Trop. São Paulo, 43, pp. 329-333CHO, W., KEZDY, F.J., Chromogenic substrate and assay of phospholipase A 2 (1991) Meth. Enzymol, 197, pp. 75-79CINTRA, A.C., MARANGONI, S., OLIVEIRA, B., GIGLIO, J.R., Bothropstoxin-I: Amino acid sequence and function (1993) J. Protein Chem, 12, pp. 57-64COGO, J.C., PRADO-FRANCESCHI, J., CRUZ-HÖFLING, M.A., CORRADO, A.P., RODRIGUES-SIMIONI, L., Effects of Bothrops insularis on the mouse and chick nerve-muscle preparation (1993) Toxicon, 31, pp. 1237-1247COGO, J.C., PRADO-FRANCESCHI, J., GIGLIO, J.R., CORRADO, A.P., CRUZ-HÖFLING, M.A., DONATO, J.L., LEITE, G.B., RODRIGUES-SIMIONI, L., An unusual presynaptic action of Bothrops insularis snake venom mediated by phospholipase A2 fraction (1998) Toxicon, 36, pp. 1323-1332DE SOUSA, M.V., MORHY, L., ARNI, R.K., WARD, R.J., GUTIÉRREZ, J.M., Amino acid sequence of a myotoxic Lys-49-phospholipase A2 homologue from the venom of Cerrophidion (Bothrops) godmani (1998) Biochim. Biophys. Acta, 1384, pp. 204-208DURIGON, A.M., BORJA-OLIVEIRA, C.R., DAL, B.C., OSHIMA-FRANCO, Y., COGO, J.C., LAPA, A.J., SOUCCAR, C., RODRIGUES-SIMIONI, L., Neuromuscular activity of Bothrops neuwiedi pauloensis snake venom in mouse nerve-muscle preparations (2005) J. Venom. Anim. Toxins incl. Trop. Dis, 11, pp. 22-33FONTES, M.R., SOARES, A.M., RODRIGUES, V.M., FERNANDES, A.C., DA SILVA, R.J., GIGLIO, J.R., Crystallization and preliminary X-ray diffraction analysis of a myotoxic phospholipase A(2) homologue from Bothrops neuwiedi pauloensis venom (1999) Biochim. Biophys. Acta, 1432, pp. 393-395FRANCIS, B., GUTIERREZ, J.M., LOMONTE, B., KAISER II, Myotoxin II from Bothrops asper (Terciopelo) venom is a lysine-49 phospholipase A 2 (1991) Arch. Biochem. Biophys, 284, pp. 352-359GEOGHEGAN, P., ANGULO, Y., CANGELOSI, A., DIAZ, M., LOMONTE, B., Characterization of a basic phospholipase A2-homologue myotoxin isolated from the venom of the snake Bothrops neuwiedii (yarara chica) from Argentina (1999) Toxicon, 37, pp. 1735-1746GINSBORG, B.L., WARRINER, J., The isolated chick biventer cervicis nerve-muscle preparation (1960) Brit. J. Pharmacol, 15, pp. 410-411HALPERT, J., EAKER, D., Amino acid sequence of a presynaptic neurotoxin from the venom of Notechis scutatus scutatus (Australian tiger snake) (1975) J. Biol. Chem, 250, pp. 6990-6997HARVEY AL., BARFARAZ A., THOMPSON E., FAIZ A., PRESTON S., HARRIS JB. Screening of snake venoms for neurotoxic and myotoxic effects using simple in vitro preparations from rodents and chicks. Toxicon, 1994, 32, 257-65HELUANY, N.F., HOMSI-BRANDEBURGO, M.I., GIGLIO, J.R., PRADO-FRANCESCHI, J., RODRIGUES-SIMIONI, L., Effects induced by bothropstoxin, a component from Bothrops jararacussu snake venom, on mouse and chick muscle preparations (1992) Toxicon, 30, pp. 1203-1210HOLZER, M., MACKESSY, S.P., An aqueous endpoint assay of snake venom phospholipase A2 (1995) Toxicon, 35, pp. 1149-1155HOMSI-BRANDEBURGO, M.I., QUEIROZ, L.S., SANTO-NETO, H., RODRIGUES-SIMIONI, L., GIGLIO, J.R., Fractionation of Bothrops jararacussu snake venom: Partial chemical characterization and biological activity of bothropstoxin (1988) Toxicon, 26, pp. 615-627JOHNSON, E.K., OWNBY, C.L., Isolation of a myotoxin from the venom of Agkistrodon contortrix laticinctus (broad-banded copperhead) and pathogenesis of myonecrosis induced by it in mice (1993) Toxicon, 31, pp. 243-255KAISER II, Gutierrez, J.M., Plummer, D., Aird, S.D., Odell, G.V., AIRD SD., ODELL GV. The amino acid sequence of a myotoxic phospholipase from the venom of Bothrops asper (1990) Arch. Biochem. Biophys, 278, pp. 319-325KATZ, B., MILEDI, R., The binding of acetylcholine to receptors and its removal from the synaptic cleft (1973) J. Physiol, 231, pp. 549-574KINI RM. Phospholipase A2 - A complex multifunctional protein puzzle. In: KINI RM. Ed., Venom phosholipase A2 enzymes. Structure, function and mechanism. New York: John Wiley &Sons Inc Chichester, 1997, 1-28KONDO, K., NARITA, K., LEE, C.Y., Amino acid sequences of the two polypeptide chains in beta1-bungarotoxin from the venom of Bungarus multicinctus (1978) J. Biochem, 83, pp. 101-115KONDO, K., TODA, H., NARITA, K., LEE, C.Y., Amino acid sequence of β2-bungarotoxin from Bungarus multicinctus venom: The amino acid substitutions in the B chains (1982) J. Biochem, 91, pp. 1519-1530KONDO, K., ZHANG, J., XU, K., KAGAMIYAMA, H., Amino acid sequence of a presynaptic neurotoxin, agkistrodotoxin, from the venom of Agkistrodon halys pallas (1989) J. Biochem, 105, pp. 196-203KORDAS, M., On the role of junctional cholinesterase in determining the time course of the end-plate current (1977) J. Physiol, 270, pp. 133-150LEE, C.Y., HO, C.L., BOTES, D.P., Site of action of caudoxin, a neurotoxic phospholipase A2 from the horned puff adder (Bitis caudalis) venom (1982) Toxicon, 20, pp. 637-647LIND, P., EAKER, D., Amino-acid sequence of the alpha-subunit of taipoxin, an extremely potent presynaptic neurotoxin from the Australian snake taipan (Oxyuranus s. scutellatus) (1982) European J. Biochem, 124, pp. 441-447MAGRO, A.J., SOARES, A.M., GIGLIO, J.R., FONTES, M.R., Crystal structures of BnSP-7 and BnSP-6, two Lys49 phospholipases A2: Quartenary structure and inhibition mechanism insights (2003) Biochem. Biophys. Res. Commun, 311, pp. 713-720MONTECUCCO, C., ROSSETTO, O., How do presynaptic PLA2 neurotoxins block nerve terminals? (2000) Trends Biochem. Sciences, 25, pp. 266-270OSHIMA-FRANCO, Y., HYSLOP, S., CINTRA, A.C., GIGLIO, J.R., DA CRUZ-HOFLING, M.A., RODRIGUES-SIMIONI, L., Neutralizing capacity of commercial bothropic antivenom against Bothrops jararacussu venom and bothropstoxin-I (2000) Muscle Nerve, 23, pp. 1832-1839OSHIMA-FRANCO, Y., LEITE, G.B., SILVA, G.H., CARDOSO, D.F., HYSLOP, S., GIGLIO, J.R., DA CRUZ-HOFLING, M.A., RODRIGUES-SIMIONI, L., Neutralization of the pharmacological effects of bothropstoxin-I from Bothrops jararacussu (jararacuçu) venom by crotoxin antiserum and heparin (2001) Toxicon, 39, pp. 1477-1485PEREIRA, M.F., NOVELLO, J.C., CINTRA, A.C., GIGLIO, J.R., LANDUCCI, E.T., OLIVEIRA, B., MARANGONI, S., The amino acid sequence of bothropstoxin-II, an Asp-49 myotoxin from Bothrops jararacussu (jararacuçu) venom with low phospholipase A2 activity (1998) J. Protein Chem, 17, pp. 381-386RE, L., BAROCCI, S., CAPITANI, C., VIVANI, C., RICCI, M., RINALDI, L., PAOLUCCI, G., MORALES, M.A., Effects of some natural extracts on the acetylcholine release at the mouse neuromuscular junction (1999) Pharmacol. Res, 39, pp. 239-245RE, L., COLA, V., FULGENZI, G., MARINELLI, F., CONCETTONI, C., ROSSINI, L., Postsynaptic effects of methoctramine at the mouse neuromuscular junction (1993) Neuroscience, 57, pp. 451-457RE, L., GIUSTI, P., CONCETTONI, C., DI SARRA, B., Computerized estimation of spontaneous and evoked acetylcholine release at the neuromuscular junction (1989) J. Pharmacol. Meth, 22, pp. 233-242RE, L., MORETTI, V., ROSSINI, L., GIUSTI, P., Sodium-activated potassium current in mouse diaphragm (1990) FEBS Lett, 270, pp. 195-197RIBEIRO, L.A., ALBUQUERQUE, M.J., PIRES DE CAMPOS VAF., KATZ G., TAKAOKAM NY., LEBRÃO ML., JORGE MT. Óbitos por serpentes peçonhentas no Estado de São Paulo: Avaliação de 43 casos, 1988/98 (1998) Rev. Assoc. Méd. Bras, 44, pp. 312-318RITONJA A., GUBENSEK F. Ammodytoxin A, a highly lethal phospholipase A2 from Vipera ammodytes ammodytes venom. Biochim. Biophys. Acta, 1985, 828, 306-12RODRIGUES-SIMIONI, L., BORGESE, N., CECCARELLI, B., The effects of Bothrops jararacussu venom and its components on frog nerve-muscle preparation (1983) Neuroscience, 10, pp. 475-489RODRIGUES-SIMIONI, L., ZAMUNER, S.R., COGO, J.C., BORJA-OLIVEIRA, C.R., PRADO-FRANCESCHI, J., CRUZ-HOFLING, M.A., CORRADO, A.P., Pharmacological evidence for a presynaptic action of venoms from Bothrops insularis (jararaca ilhoa) and Bothrops neuwiedi (jararaca pintada) (2004) Toxicon, 43, pp. 633-638SCHAGGER, H., VON JAGOW, G., Tricine-sodium dodecyl sulfate-polyacrylamide gel electrophoresis for the separation of proteins in the range from 1 to 100kDa (1987) Anal. Biochem, 166, pp. 368-379SOARES, A.M., GUERRA-SÁ, R., BORJA-OLIVEIRA, C.R., RODRIGUES, V.M., RODRIGUES-SIMIONI, L., RODRIGUES, V., FONTES, M.R.M., GIGLIO, J.R., Structural and functional characterization of BnSP-7, a Lys49 myotoxic phospholipase A2 homologue from Bothrops neuwiedi venom (2000) Arch. Biochem. Biophys, 378, pp. 201-209STÜHMER, W., ROBERTS, W.M., ALMERS, W., The loose patch clamp (1983) Single Channel Recording, p. 123. , SAKMANN B AND NEHER E, Eds, Plenum Press, New York;TOYAMA, M.H., SOARES, A.M., WEN-HWA, L., POLIKARPOV, I., GIGLIO, J.R., MARANGONI, S., Amino acid sequence of piratoxin-II, a myotoxic lys49 phospholipase A 2 homologue from Bothrops pirajai venom (2000) Biochimie, 82, pp. 245-250TSAI, I.H., LU, P.J., WANG, Y.M., HO, C.L., LIAW, L.L., Molecular cloning and characterization of a neurotoxic phospholipase A2 from the venom of Taiwan habu (Trimeresurus mucrosquamatus) (1995) Biochem. J, 311, pp. 895-900VAN DEN BERGH, C.J., SLOTBOOM, A.J., VERHEIJ, H.M., DE HAAS, G.H., The role of aspartic acid-49 in the active site of phospholipase A2. A site-specific mutagenesis study of porcine pancreatic phospholipase A 2 and the rationale of the enzymatic activity of Lys-49 phospholipase A2 from Agkistrodon piscivorus piscivorus venom (1988) European J. Biochem, 176, pp. 353-357VAN DEENEN LL, D.H.G., The substrate specificity of phospholipases A2 (1963) Biochim. Biophys. Acta, 70, pp. 538-553VILJOEN, C.C., BOTES, D.P., KRUGER, H., Isolation and amino acid sequence of caudoxin, a presynaptic acting toxic phospholipase A2 from the venom of the horned puff adder (Bitis caudalis) (1982) Toxicon, 20, pp. 715-737ZAMUNER, S.R., PRADO-FRANCESCHI, J., RODRIGUES-SIMIONI, L., The screening of Bothrops venoms for neurotoxic activity using the chick biventer cervicis preparation (1996) Toxicon, 34, pp. 314-31
Cross-neutralization Of The Neurotoxicity Of Crotalus Durissus Terrificus And Bothrops Jararacussu Venoms By Antisera Against Crotoxin And Phospholipase A2 From Crotalus Durissus Cascavella Venom
No full textWe have previously demonstrated that rabbit antisera raised against crotoxin from Crotalus durissus cascavella venom (cdc-crotoxin) and its PLA 2 (cdc-PLA2) neutralized the neurotoxicity of this venom and its crotoxin. In this study, we examined the ability of these antisera to neutralize the neurotoxicity of Crotalus durissus terrificus and Bothrops jararacussu venoms and their major toxins, cdt-crotoxin and bothropstoxin-I (BthTX-I), respectively, in mouse isolated phrenic nerve-diaphragm preparations. Immunoblotting showed that antiserum to cdc-crotoxin recognized cdt-crotoxin and BthTX-I, while antiserum to cdc-PLA2 recognized cdt-PLA 2 and BthTX-I. ELISA corroborated this cross-reactivity. Antiserum to cdc-crotoxin prevented the neuromuscular blockade caused by C. d. terrificus venom and its crotoxin at a venom/crotoxin:antiserum ratio of 1:3. Antiserum to cdc-PLA2 also neutralized the neuromuscular blockade caused by C. d. terrificus venom or its crotoxin at venom or toxin:antiserum ratios of 1:3 and 1:1, respectively. The neuromuscular blockade caused by B. jararacussu venom and BthTX-I was also neutralized by the antisera to cdc-crotoxin and cdc-PLA 2 at a venom/toxin:antiserum ratio of 1:10 for both. Commercial equine antivenom raised against C. d. terrificus venom was effective in preventing the neuromuscular blockade typical of B. jararacussu venom (venom:antivenom ratio of 1:2), whereas for BthTX-I the ratio was 1:10. These results show that antiserum produced against PLA2, the major toxin in C. durissus cascavella venom, efficiently neutralized the neurotoxicity of C. d. terrificus and B. jararacussu venoms and their PLA2 toxins.466604611Beghini, D.G., Toyama, M.H., Hyslop, S., Sodek, L., Novello, J.C., Marangoni, S., Enzymatic characterization of a novel phospholipase A2 from crotalus durissus cascavella rattlesnake (maracambóia) venom (2000) J. Protein Chem., 19, pp. 603-607Beghini, D.G., Hernandez-Oliveira, S., Rodrigues-Simioni, L., Novello, J.C., Hyslop, S., Marangoni, S., Anti-sera raised in rabbits against crotoxin and phospholipase A 2 from Crotalus durissus cascavella venom neutralize the neurotoxicity of the venom and crotoxin (2004) Toxicon, 44, pp. 141-148Beghini, D.G., Rodrigues-Simioni, L., Toyama, M.H., Novello, J.C., Cruz-Höfling, M.A., Marangoni, S., Neurotoxic and myotoxic actions of crotoxin 'like' and crotalus durissus cascavella whole venom in the chick biventer cervicis preparation (2004) Toxicon, 43, pp. 255-261Brazil, V., Contribuição ao estudo do veneno ophidico. III. Tratamento das mordeduras de cobras (1903) Rev. Med. São Paulo, 6, pp. 265-278Brazil, V., Pestana, R., Nova contribuicao ao estudo do envenenamento ophidico (1909) Ver. Méd. São Paulo, 19, pp. 21-22Breithaupt, H., Enzymatic characteristics of Crotalus phospholipase A2 and the crotoxin complex (1976) Toxicon, 14, pp. 221-233Bülbring, E., Observation on the isolated phrenic nerve diaphragm preparation of the ratr (1946) Br. J. Pharmacol., 1, pp. 38-61Chavez-Olórtegui, C., Silva Lopes, C., Drumond Cordeiro, F., Granier, C., Diniz, C.R., An enzyme linked immunosorbent assay (ELISA) that discriminates between Bothrops atrox and Lachesis muta muta venoms (1993) Toxicon, 31, pp. 417-425Choumet, V., Jiang, M.S., Radvanyi, F., Ownby, C., Bon, C., Neutralization of lethal potency and inhibition of enzymatic activity of a phospholipase A2 neurotoxin, crotoxin, by non-precipitating antibodies (Fab) (1989) Fed. Eur. Biochem. Soc. Lett., 244, pp. 167-173Choumet, V., Faure, G., Robbe-Vincent, A., Saliou, B., Mazié, J.C., Bon, C., Immunochemical analysis of a snake venom phospholipase A2 neurotoxin, crotoxin, with monoclonal antibodies (1992) Mol. Immunol., 29, pp. 871-882Cintra, A.C., Marangoni, S., Oliveira, B., Giglio, J.R., Bothropstoxin-I: Amino acid sequence and function (1993) J. Protein Chem., 12, pp. 57-64Dennis, E.A., Diversity of group types, regulation, and function of phospholipase A2 (1994) J. Biol. Chem., 269, pp. 13057-13060Dessen, A., Phospholipase A2 enzymes: Structural diversity in lipid messenger metabolism (2000) Struct. Fold Des., 8, pp. 15-R22Dos-Santos, M.C., Gonçalvez, L.R., Fortes-Dias, C.L., Cury, Y., Gutiérrez, J.M., Furtado, M.F., Estudo comparativo do efeito neutralizante dos soros antibotrópico (SAB) e antibotrópico/crotálico (SAB-C) sobre atividade miotóxica do veneno de Bothrops jararacussu (Bjssu) em camundongos (1990) Mem. Inst. Butantan, 52, p. 71Dos-Santos, M.C., Gonçalvez, L.R., Fortes-Dias, C.L., Cury, Y., Gutiérrez, J.M., Furtado, M.F., A eficácia do antiveneno botrópico-crotálico na neutralização das principais atividades do veneno de Bothrops jararacussu (1992) Rev. Inst. Med. Trop. S. Paulo, 34, pp. 77-83Freitas, T.V., Fortes-Dias, C.L., Diniz, C.R., Protection against the lethal effects of Crotalus durissus terrificus (South American rattlesnake) venom in animals immunized with crotoxin (1990) Toxicon, 28, pp. 1491-1496Fuly, A.L., Soares, A.M., Marcussi, S., Giglio, J.R., Guimarães, J.A., Signal transduction pathways involved in the platelet aggregation induce by a D-49 phospholipase isolated from Bothrops jararacussu snake venom (2004) Biochimie, 86, pp. 731-739Heluany, N.F., Homsi-Brandeburgo, M.I., Giglio, J.R., Prado-Franceschi, J., Rodrigues-Simioni, L., Effects induced by bothropstoxin, a component from bothrops jararacussu snake venom on mouse and chick muscle preparations (1992) Toxicon, 30, pp. 1203-1210Hendon, R.A., Fraenkel-Conrat, H., Biological roles of the two components of crotoxin (1971) Proc. Natl Acad. Sci. USA, 68, pp. 1560-1563Homsi-Brandeburgo, M.I., Queiroz, L.S., Santo-Neto, H., Rodrigues-Simioni, L., Giglio, J.R., Fractionation of bothrops jararacussu snake venom: Partial chemical characterization and biological activity of bothropstoxin (1988) Toxicon, 26, pp. 615-627Kashima, S., Roberto, P.G., Soares, A.M., Asolfi-Filho, S., Pereira, J.O., Giuliati, S., Faria Jr., M., França, S.C., Analysis of Bothrops jararacussu venomous gland transcriptome focusing on structural and functional aspects: I. Gene expression profile of highly expressed phospholipases A2 (2004) Biochimie, 86, pp. 211-219Ketelhut, D.F.J., Homem De Mello, M., Veronese, E.L.G., Esmeraldino, L.E., Murakami, M.T., Arni, R.K., Giglio, J.R., Sampaio, S.V., Isolation, characterization and biological activity of acidic phospholipase A2 isoforms from Bothrops jararacussu snake venom (2003) Biochimie, 85, pp. 983-991Kini, R.M., Excitement ahead: Structure, function and mechanism of snake venom phospholipase A2 enzymes (2003) Toxicon, 42, pp. 827-840Landucci, E.C., Condino-Neto, A., Perez, A.C., Hyslop, S., Corrado, A.P., Novello, J.C., Marangoni, S., De Nucci, G., Crotoxin induces aggregation of human washed platelets (1994) Toxicon, 32, pp. 217-226Melgarejo, A.R., Serpentes peçonhentas do Brasil (2003) Animais Peçonhentos no Brasil Biologia, Clínica e Terapêutica Dos Acidentes, pp. 33-61. , J.L.C. Cardoso F.O. França F. Hui Wen C.M. Málaque V. Haddad Jr Sarvier São PauloMénez, A., Molecular immunology of snake toxins (1985) Pharmacol. Ther., 30, pp. 91-113Middlebrook, J.L., Kaiser, S., Immunological relationship of phospholipase A2 neurotoxins from snake venoms (1989) Toxicon, 22, pp. 965-977Mollier, P., Chwetzoff, S., Menez, A., A monoclonal antibody recognizing a conserved epitope in a group of phospholipases A2 (1990) Mol. Immunol., 27, pp. 7-15Oshima-Franco, Y., Hyslop, S., Prado-Franceschi, J., Cruz-Höfling, M.A., Rodrigues-Simioni, L., Neutralizing capacity of antisera raised in horses and rabbits against crotalus durissus terrificus (South American rattlesnake) venom and its main toxin, crotoxin (1999) Toxicon, 37, pp. 1341-1457Oshima-Franco, Y., Leite, G.B., Silva, G.H., Cardoso, D.F., Hyslop, S., Giglio, J.R., Cruz-Höfling, M.A., Rodrigues-Simioni, L., Neutralization of the pharmacological effects of bothropstoxin-I from Bothrops jararacussu (jararacuçu) venom by crotoxin antiserum and heparin (2001) Toxicon, 39, pp. 1477-1485Pereira, M.F., Novello, J.C., Cintra, A.C., Giglio, J.R., Landucci, E.T., Oliveira, B., Marangoni, S., The amino acid sequence of bothropstoxin-II, an Asp-49 myotoxin from Bothrops jararacussu (jararacuçu) venom with low phospholipase A 2 activity (1998) J. Protein Chem., 17, pp. 381-386Santoro, M.L., Sousa-E-Silva, M.C.C., Gonçalvez, L.R.C., Almeida-Santos, S.M., Cardoso, D.F., Laporta-Ferreira, I.L., Saiki, M., Sano-Martins, I.S., Comparison of the biological activities in venoms from three subspecies of the South American rattlesnake (Crotalus durissus terrificus, C. durissus cascavella and C. durissus collilineatus) (1999) Comp. Biochem. Physiol., 122, pp. 61-73Slotta, K.H., Fraenkel-Conrat, H.L., Schlangengifte. III: Mitteilung reiningung und Krystallization des klapperschangengiftes (1938) Ber. Dich. Chem. Ges., 71, pp. 1076-1081Strong, P.N., Wood, J.N., Ivanyi, J., Characterization of monoclonal antibodies against β-BTX and their use as structural probes for related phospholipase A2 enzymes and presynaptic phospholipase neurotoxins (1984) Eur. J. Biochem., 142, pp. 145-151Vital Brazil, O., Pharmacology of crystalline crotoxin. II. Neuromuscular blocking action (1966) Mem. Inst. Butantan, 33, pp. 981-992Zamuner, S.R., Da Cruz-Hofling, M.A., Corrado, A.P., Hyslop, S., Rodrigues-Simioni, L., Comparison of the neurotoxic and myotoxic effects of brazilian bothrops venoms and their neutralization by commercial antivenom (2004) Toxicon, 44, pp. 259-27
The Neuromuscular Activity Of Bothriopsis Bilineata Smaragdina (forest Viper) Venom And Its Toxin Bbil-tx (asp49 Phospholipase A2) On Isolated Mouse Nerve-muscle Preparations
No full textThe presynaptic action of Bothriopsis bilineata smaragdina (forest viper) venom and Bbil-TX, an Asp49 PLA2 from this venom, was examined in detail in mouse phrenic nerve-muscle (PND) preparations in vitro and in a neuroblastoma cell line (SK-N-SH) in order to gain a better insight into the mechanism of action of the venom and associated Asp49 PLA2. In low Ca2+ solution, venom (3 μg/ml) caused a quadriphasic response in PND twitch height whilst at 10 μg/ml the venom additionally induced an abrupt and marked initial contracture followed by neuromuscular facilitation, rhythmic oscillations of nerve-evoked twitches, alterations in baseline and progressive blockade. The venom slowed the relaxation phase of muscle twitches. In low Ca2+, Bbil-TX [210 nM (3 μg/ml)] caused a progressive increase in PND twitch amplitude but no change in the decay time constant. Venom (10 μg/ml) and Bbil-TX (210 nM) caused minor changes in the compound action potential (CAP) amplitude recorded from sciatic nerve preparations, with no significant effect on rise time and latency; tetrodotoxin (3.1 nM) blocked the CAP at the end of the experiments. In mouse triangularis sterni nerve-muscle (TSn-m) preparations, venom (10 μg/ml) and Bbil-TX (210 nM) significantly reduced the perineural waveform associated with the outward K+ current while the amplitude of the inward Na+ current was not significantly affected. Bbil-TX (210 nM) caused a progressive increase in the quantal content of TSn-m preparations maintained in low Ca2+ solution. Venom (3 μg/ml) and toxin (210 nM) increased the calcium fluorescence in SK-N-SH neuroblastoma cells loaded with Fluo3 AM and maintained in low or normal Ca2+ solution. In normal Ca2+, the increase in fluorescence amplitude was accompanied by irregular and frequent calcium transients. In TSn-m preparations loaded with Fluo4 AM, venom (10 μg/ml) caused an immediate increase in intracellular Ca2+ followed by oscillations in fluorescence and muscle contracture; Bbil-TX did not change the calcium fluorescence in TSn-m preparations. Immunohistochemical analysis of toxin-treated PND preparations revealed labeling of junctional ACh receptors but a loss of the presynaptic proteins synaptophysin and SNAP25. Together, these data confirm the presynaptic action of Bbil-TX and show that it involves modulation of K+ channel activity and presynaptic protein expression.962437Borja-Oliveira, C.R., Kassab, B.H., Soares, A.M., Toyama, M.H., Giglio, J.R., Marangoni, S., Re, L., Rodrigues-Simioni, L., Purification and N-terminal sequencing of two presynaptic neurotoxic PLA2, neuwieditoxin-I and neuwieditoxin-II, from Bothrops neuwiedi pauloensis (jararaca pintada) venom (2007) J. Venom. Anim. Toxins Incl. Trop. Dis., 13, pp. 103-121Braga, M.F., Anderson, A.J., Harvey, A.L., Rowan, E.G., Apparent block of K+ currents in mouse motor nerve terminals by tetrodotoxin, mu-conotoxin and reduced external sodium (1992) Br. J. Pharmacol., 106, pp. 91-94Calgarotto, A.K., Damico, D.C.S., Ponce-Soto, L.A., Baldasso, P.A., Da Silva, S.L., Souza, G.H.M.F., Eberlin, M.N., Marangoni, S., Biological and biochemical characterization of a new basic phospholipase A2 BmTX-I isolated from Bothrops moojeni snake venom (2008) Toxicon, 51, pp. 1509-1519Campbell, J.A., Lamar, W.W., (2004) Venomous Reptiles of the Western Hemisphere, 2. , Comstock Publishing Associates/Cornell University Press IthacaCarregari, V.C., Floriano, R.S., Rodrigues-Simioni, L., Winck, F.V., Baldasso, P.A., Ponce-Soto, L.A., Marangoni, S., Biochemical, pharmacological, and structural characterization of new basic PLA2 Bbil-TX from Bothriopsis bilineata snake venom (2013) BioMed. Res. Int., 2013. , Article ID 612649, 12 pagesChang, C.C., Su, M.J., Presynaptic toxicity of the histidine-modified, phospholipase A2-inactive β-bungarotoxin, crotoxin and notexin (1982) Toxicon, 20, pp. 895-905Chang, C.C., Lee, J.D., Eaker, D., Fohlman, J., The presynaptic neuromuscular blocking action of taipoxin. A comparison with β-bungarotoxin and crotoxin (1977) Toxicon, 15, pp. 571-576Cogo, J.C., Prado-Franceschi, J., Cruz-Höfling, M.A., Corrado, A.P., Rodrigues-Simioni, L., Effect of Bothrops insularis venom on the mouse and chick nerve-muscle preparation (1993) Toxicon, 31, pp. 1237-1247Cogo, J.C., Lilla, S., Souza, G.H.M.F., Hyslop, S., Nucci, G., Purification, sequencing and structural analysis of two acidic phospholipases A2 from the venom of Bothrops insularis (jararaca ilhoa) (2006) Biochimie, 88, pp. 1947-1959Correia-De-Sá, P., Noronha-Matos, J.B., Timóteo, M.A., Ferreirinha, F., Marques, P., Soares, A.M., Carvalho, C., Gallacci, M., Bothropstoxin-I reduces evoked acetylcholine release from rat motor nerve terminals: Radiochemical and real-time video-microscopy studies (2013) Toxicon, 61, pp. 16-25Dal Belo, C.A., Leite, G.B., Toyama, M.H., Marangoni, S., Corrado, A.P., Fontana, M.D., Southand, A., Rodrigues-Simioni, L., Pharmacological and structural characterization of a novel phospholipase A2 from Micrurus dumerilii carinicauda venom (2005) Toxicon, 46, pp. 736-750Dempster, J., Computer analysis of electrophysiological signals (1988) Microcomputers in Physiology: A Practical Approach, pp. 51-93. , P.J. Frazer, IRL Press OxfordDixon, R.W., Harris, J.B., Nerve terminal damage by β-bungarotoxin - Its clinical significance (1999) Am. J. Pathol., 154, pp. 447-455Dreyer, F., Penner, R., The actions of presynaptic snake toxins on membrane currents of mouse motor nerve terminals (1987) J. Physiol., 386, pp. 455-463Dumitru, D., Amato, A.A., (2008) Neuromuscular Disorders, pp. 1127-1212. , McGraw-Hill Education Columbus, OHFaiz, A., Ghose, A., Ahsan, F., Rahman, R., Amin, R., Hassan, M.U., Chowdhury, A.W., Warrell, D.A., The greater black krait (Bungarus niger), a newly recognized cause of neuro-myotoxic snake bite envenoming in Bangladesh (2010) Brain, 133, pp. 3181-3193Fatehi, M., Harvey, A.L., Rowan, E.G., Characterisation of the effects of depolarising toxins on nerve terminal action potentials: Apparent block of presynaptic potassium currents (1998) Toxicon, 36, pp. 115-129Fathi, B., Rowan, E.G., Harvey, A.L., The facilitatory actions of snake venom phospholipase A2 neurotoxins at the neuromuscular junction are not mediated through voltage-gated K+ channels (2001) Toxicon, 39, pp. 1871-1882Fathi, B., Harvey, A.L., Rowan, E.G., The effect of temperature on the effects of the phospholipase A2 neurotoxins β-bungarotoxin and taipoxin at the neuromuscular junction (2013) Toxicon, 70, pp. 86-89Floriano, R.S., Carregari, V.C., Abreu, V.A., Kenzo-Kagawa, B., Ponce-Soto, L.A., Cruz-Höfling, M.A., Hyslop, S., Rodrigues-Simioni, L., Pharmacological study of a new Asp49 phospholipase A2 (Bbil-TX) isolated from Bothriopsis bilineata smargadina (forest viper) venom in vertebrate neuromuscular preparations (2013) Toxicon, 69, pp. 191-199Fohlman, J., Eaker, D., Karlsson, E., Thesleff, S., Taipoxin, an extremely potent presynaptic neurotoxin from the venom of the Australian snake taipan (Oxyuranus S. Scutellatus) (1976) Eur. J. Biochem., 68, pp. 457-469França, F.O.S., Málaque, C.M.S., Acidente botrópico (2003) Animais Peçonhentos No Brasil: Biologia, Clínica e Terapêutica Dos Acidentes, pp. 72-86. , J.L.C. Cardoso, F.O.S. França, F.H. Wen, C.M.S. Málaque, V. Haddad Jr. Sarvier/FAPESP São PauloGalbiatti, C., Rocha, T., Randazzo-Moura, P., Ponce-Soto, L.A., Marangoni, S., Cruz-Höfling, M.A., Rodrigues-Simioni, L., Pharmacological and partial biochemical characterization of a new non-myotoxic neurotoxic PLA2 (Bmaj-9) isolated from Bothrops marajoensis snake venom (2012) J. Venom. Anim. Toxins Incl. Trop. Dis., 18, pp. 62-72Gallacci, M., Cavalcante, W.L., Understanding the in vitro neuromuscular activity of snake venom Lys49 phospholipase A2 homologues (2010) Toxicon, 55, pp. 1-11Harris, J.B., Neuron to nerve terminals: Aspects of neuropathology and toxinology (2006) Braz. J. Morphol. Sci., 23, pp. 195-216Harvey, A.L., Marshall, R.J., Karlsson, E., Effects of purified cardiotoxins from the Thailand cobra (Naja naja siamensis) on isolated skeletal and cardiac muscle preparations (1982) Toxicon, 20, pp. 379-396Lin-Shiau, S.Y., Fu, W.M., Liu, S.H., Ni, C.T., Studies on contractures induced in mouse diaphragm by caffeine and cupric and selenite ions (1989) Arch. Int. Pharmacodyn. Ther., 300, pp. 265-280Logantha, S.J.R.J., Cruickshank, S.F., Rowan, E.G., Drummond, R.M., Spontaneous and electrically evoked Ca2+ transients in cardiomyocytes of the rat pulmonary vein (2010) Cell Calcium, 48, pp. 150-160Lomonte, B., Angulo, Y., Calderón, L., An overview of lysine-49 phospholipase A2 myotoxins from crotalid snake venoms and their structural determinants of myotoxic action (2003) Toxicon, 42, pp. 885-901McArdle, J.J., Angaut-Petit, D., Mallart, A., Bournaud, R., Faille, L., Brigant, J.L., Advantages of the triangularis sterni muscle of the mouse for investigations of synaptic phenomena (1981) J. Neurosci. Methods, 4, pp. 109-115Montecucco, C., Rossetto, O., How do presynaptic PLA2 neurotoxins block nerve terminals? (2000) Trends Biochem. Sci., 25, pp. 266-270Moraes, D.S., De Abreu, V.A., Rostelato-Ferreira, S., Leite, G.B., Cruz-Höfling, M.A., Travaglia-Cardoso, S.R., Hyslop, S., Rodrigues-Simioni, L., Neuromuscular activity of Bothrops alcatraz snake venom in chick biventer cervicis preparations (2012) Toxicon, 59, pp. 294-299Oshima-Franco, Y., Leite, G.B., Belo, C.A., Hyslop, S., Prado-Franceschi, J., Cintra, A.C., Giglio, J.R., Rodrigues-Simioni, L., The presynaptic activity of bothropstoxin-I, a myotoxin from Bothrops jararacussu snake venom (2004) Basic Clin. Pharmacol. Toxicol., 95, pp. 175-182Penner, R., Dreyer, F., Two different presynaptic calcium currents in mouse nerve terminals (1986) Pflugers Arch., 406, pp. 190-197Ponce-Soto, L.A., Barros, J.C., Marangoni, S., Hernandez, S., Dal Belo, C.A., Corrado, A.P., Hyslop, S., Rodrigues-Simioni, L., Neuromuscular activity of BaTX, a presynaptic basic PLA2 isolated from Bothrops alternatus snake venom (2009) Comp. Biochem. Physiol. C, 150, pp. 291-297Pungerčar, J., Križaj, I., Understanding the molecular mechanism underlying the presynaptic toxicity of secreted phospholipases A2 (2007) Toxicon, 50, pp. 871-892Rocha, T., De Souza, B.M., Palma, M.S., Cruz-Höfling, M.A., Harris, J.B., The neurotoxicological effects of mastoparan Polybia-MPII at the murine neuromuscular junction: An ultrastructural and immunocytochemical study (2009) Histochem. Cell Biol., 132, pp. 395-404Rodrigues-Simioni, L., Zamunér, S.R., Cogo, J.C., Borja-Oliveira, C.R., Prado-Franceschi, J., Cruz-Höfling, M.A., Corrado, A.P., Pharmacological evidence for a presynaptic action of venoms from Bothrops insularis (jararaca ilhoa) and Bothrops neuwiedi (jararaca pintada) (2004) Toxicon, 43, pp. 633-638Rodrigues-Simioni, L., Floriano, R.S., Rostelato-Ferreira, S., Sousa, N.C., Marangoni, S., Ponce-Soto, L.A., Carregari, V.C., Hyslop, S., Presynaptic action of Bothriopsis bilineata smargadina (forest viper) venom in vitro (2011) Toxicon, 58, pp. 140-145Rossetto, O., Montecucco, C., Presynaptic neurotoxins with enzymatic activities (2008) Handb. Exp. Pharmacol., 184, pp. 129-170Rossetto, O., Rigoni, M., Montecucco, C., Different mechanism of blockade of neuroexocytosis by presynaptic neurotoxins (2004) Toxicol. Lett., 149, pp. 91-101Rowan, E.G., What does β-bungarotoxin do at the neuromuscular junction? (2001) Toxicon, 39, pp. 107-118Rowan, E.G., Harvey, A.L., Potassium channel blocking actions of β-bungarotoxin and related toxins on mouse and frog motor nerve terminals (1988) Br. J. Pharmacol., 94, pp. 839-847Rowan, E.G., Pemberton, K.E., Harvey, A.L., On the blockade of acetylcholine release at mouse motor nerve terminals by β-bungarotoxin and crotoxin (1990) Br. J. Pharmacol., 100, pp. 301-304Simpson, L.L., Lautenslager, G.T., Kaiser, I.I., Middlebrook, J.L., Identification of the site at which phospholipase A2 neurotoxins localise to produce their neuromuscular blocking effects (1993) Toxicon, 31, pp. 13-26Soares, A.M., Giglio, J.R., Chemical modifications on phospholipases A2 from snake venoms: Effects on catalytic and pharmacological properties (2003) Toxicon, 42, pp. 855-868Su, M.J., Chang, C.C., Presynaptic effects of snake venom toxins which have phospholipase A2 activity (β-bungarotoxin, taipoxin, crotoxin) (1984) Toxicon, 22, pp. 631-640Tedesco, E., Rigonia, M., Caccin, P., Grishin, E., Rossetto, O., Montecucco, C., Calcium overload in nerve terminals of cultured neurons intoxicated by α-latrotoxin and snake PLA2 neurotoxins (2009) Toxicon, 54, pp. 138-144Warrell, D.A., Snakebites in Central and South America: Epidemiology, clinical features and clinical management (2004) Venomous Reptiles of the Western Hemisphere, 2, pp. 709-761. , J.A. Campbell, W.W. Lamar, Comstock Publishing Associates/Cornell University Press IthacaZamunér, S.R., Cruz-Höfling, M.A., Corrado, A.P., Hyslop, S., Rodrigues-Simioni, L., Comparison of the neurotoxic and myotoxic effects of Brazilian Bothrops venoms and their neutralization by commercial antivenom (2004) Toxicon, 44, pp. 259-27
Protection By Mikania Laevigata (guaco) Extract Against The Toxicity Of Philodryas Olfersii Snake Venom
No full textPhilodryas olfersii is responsible for most colubrid snakebites in Brazil. In this work, we examined the ability of an ethanolic extract from Mikania laevigata (guaco) leaves to protect against the in vitro neuromuscular activity of P. olfersii venom in mouse phrenic nerve-diaphragm (PND) and chick biventer cervicis (BC) preparations. M. laevigata extract caused moderate twitch-tension facilitation at low concentrations (107.4 ± 6.2% with 20 μl/ml and 118.9 ± 9.3% with 40 μl/ml in PND, and 120.7 ± 7.7% with 40 μl/ml and 114.5 ± 4.4% with 50 μl/ml in BC after 120 min; n = 4-6, mean ± SEM). In PND, the ethanol alone (40 μl/ml, n = 4) did not change the twitch-tension when compared with control. However, in BC, the ethanol produced a higher facilitation when compared to control. At higher concentrations (>50 μl/ml) the extract caused total and reversible blockade in both preparations. Venom (50 μg/ml) caused partial blockade in PND (58.5 ± 12%, n = 4) and almost total blockade in BC (93.5 ± 2.2%, n = 4). Pretreatment of the preparations with extract (40 μl/ml) for 30 min before incubation with venom (50 μg/ml) completely protected PND from neuromuscular blockade and delayed the blockade in BC. The extract alone caused only mild morphological alterations (12.5 ± 0.5% and 10.9 ± 2.3% fiber damage in PND and BC, respectively, compared to 2.3 ± 0.3% and 3 ± 0 in controls; n = 3), with no increase in expression of the inflammatory cytokines TNFα and IFNγ. The ethanol alone also caused slight muscle damage: 4.3 ± 2.4% in PND and 6.7 ± 3.3% in BC (both n = 3) and little or no TNFα and IFNγ expression in both preparations as observed in control. Venom (50 μg/ml) caused 53.5 ± 8.5% and 55.8 ± 4.3% fiber damage in PND and BC, respectively; (n = 3, p < 0.05 vs. controls) and enhanced expression of TNFα and IFNγ. Pretreatment of the preparations with extract protected against venom-induced muscle damage by 80.3 and 60.4 in PND and BC, respectively, and prevented TNFα and IFNγ expression. These results indicate that the M. laevigata extract protected nerve-muscle preparations against the myotoxic, neurotoxic and inflammatory effects of P. olfersii venom. © 2012 Elsevier Ltd.604614622Abbas, A.K., Lichtman, A.H., (2005) Imunologia Celular e Molecular, , Elsevier, Rio de JaneiroAbreu, V.A., Dal-Belo, C.A., Hernandes-Oliveira, S.S., Borja-Oliveira, C.R., Hyslop, S., Furtado, M.F., Rodrigues-Simioni, L., Neuromuscular and phospholipase activities of venoms from three subspecies of Bothrops neuwiedi (B. n. goyazensis, B. n. paranaensis and B. n. diporus) (2007) Comp. Biochem. Physiol. A Mol. Integr. Physiol., 148, pp. 142-149Acordi-da-Silva, G., (2008), MSc dissertation, Universidade do Extremo Sul Catarinense (UESC), Criciúma, SC, BrazilAcosta de Pérez, O., Leiva de Vila, L., Peichoto, M.E., Maruñak, S., Ruíz, R., Teibler, P., Gay, C., Rey, L., Edematogenic and myotoxic activities of the Duvernoy's gland secretion of Philodryas olfersii from the north-east region of Argentina (2003) Biocell, 27, pp. 363-370Alarcón, J.C.P., Quinchia, L.B., Ciro, G.G., Jiménez, S.R., Díaz, A.C., Recolección seminal intracapsular, una variable a considerar en la germinación in vitro de semillas de achiote (Bixa orellana L.), planta com actividad antiofídica (2005) Vitae (Medellín), 12, pp. 29-35Alarcón, J.C.P., Martínez, D.M.R., Quintana, C., Juan, C., Jiménez, S.R., Díaz, A.D., Jiménez, I., Propagación in vitro de Renealmia alpinia (Rottb.), planta con actividad antiofídica (2008) Vitae (Medellín), 15, pp. 61-69Alves, C.F., Alves, V.B., de Assis, I.P., Clemente-Napimoga, J.T., Uber-Bucek, E., Dal-Secco, D., Cunha, F.Q., Napimoga, M.H., Anti-inflammatory activity and possible mechanism of extract from Mikania laevigata in carrageenan-induced peritonitis (2009) J. Pharm. Pharmacol., 61, pp. 1097-1104Anderson, A.J., Haevey, A.L., Rowan, E.J., Strong, P.N., Effects of charybdotoxin, a blocker of Ca 2+-activated K + channels, on motor nerve terminals (1988) Br. J. Pharmacol., 95, pp. 1329-1335Appel, S.B., Liu, Z., McElvain, M.A., Brodie, M.S., Ethanol excitation of dopaminergic ventral tegmental area neurons is blocked by quinidine (2003) J. Pharmacol. Exp. Ther., 306, pp. 437-446Assakura, M.T., Salomão, M.G., Puorto, G., Mandelbaum, F.R., Hemorrhagic, fibrinogenolytic and edema-forming activities of the venom of the colubrid snake Philodryas olfersii (green snake) (1992) Toxicon, 30, pp. 427-438Baratto, L., Lang, K.L., Vanz, D.C., Reginatto, F.H., Oliveira, J.B., Falkenberg, M., Investigação das atividades alelopática e antimicrobiana de Mikania laevigata (Asteraceae) obtida de cultivos hidropônico e tradicional (2008) Rev. Bras. Farmacog., 18, pp. 577-582Barbosa-Filho, J.M., Vasconcelos, T.H.C., Alencar, A.A., Batista, L.M., Oliveira, R.A.G., Guedes, D.N., Falcão, H.S., Modesto-Filho, J., Plants and their active constituents from South, Central, and North America with hypoglycemic activity (2005) Rev. Bras. Farmacog., 15, pp. 392-413Bighetti, A.E., Antônio, M.A., Kohn, L.K., Rehder, V.L.G., Foglio, M.A., Posseri, A., Vilela, L., Carvalho, J.E., Antiulcerogenic activity of a crude hydroalcoholic extract and coumarin isolated from Mikania laevigata Schultz Bip (2005) Phytomedicine, 12, pp. 72-77Bolina, R.C., Garcia, E.E., Duarte, M.G.R., Estudo comparativo da composição química das espécies vegetais Mikania glomerata Sprengel e Mikania laevigata Schultz Bip. ex Baker (2009) Rev. Bras. Farmacog., 19, pp. 294-298Borges, M.H., Soares, A.M., Rodrigues, V.M., Andrião-Escarso, S.H., Diniz, H., Hamaguchi, A., Quintero, A., Homsi-Brandeburgo, M.I., Effects of aqueous extract of Casearia sylvestris (Flacourtiaceae) on actions of snake and bee venoms and on activity of phospholipases A 2 (2000) Comp. Biochem. Physiol. B Biochem. Mol. Biol., 127, pp. 21-30Botsaris, A.S., Plants used traditionally to treat malaria in Brazil: the archives of Flora Medicinal (2007) J. Ethnob. Ethnomed., 3, p. 18Bülbring, E., Observation on the isolated phrenic nerve diaphragm preparation of the rat (1946) Br. J. Pharmacol., 1, pp. 38-61Carreiro-da-Costa, R.S., Prudêncio, L., Ferrari, E.F., Souza, G.H., Mello, S.M., Prianti, A.C.G., Ribeiro, W., Cogo, J.C., Neuromuscular action of venom from the South American colubrid snake Philodryas patagoniensis (2008) Comp. Biochem. Physiol. C Toxicol. Pharmacol., 148, pp. 31-38Chen, S.E., Gerken, E., Zhang, Y., Zhan, M., Mohan, R.K., Li, A.S., Reid, M.B., Li, Y.P., Role of TNF-α signaling in regeneration of cardiotoxin injured muscle (2005) Am. J. Physiol. Cell Physiol., 289, pp. C1179-C1187Cheng, M., Nguyen, M.H., Fantuzzi, G., Koh, T.J., Endogenous interferon gamma is required for efficient skeletal muscle regeneration (2008) Am. J. Physiol. Cell Physiol., 294, pp. C1183-C1191Cogo, J.C., Prado-Franceschi, J., Cruz-Höfling, M.A., Corrado, A.P., Rodrigues-Simioni, L., Effect of Bothrops insularis venom on the mouse and chick nerve-muscle preparation (1993) Toxicon, 31, pp. 1237-1247Correia, J.M., Santana-Neto, P.L., Pinho, M.S.S., Afrânio-da-Silva, J., Amorim, M.L.P., Escobar, J.A.C., Poisoning due to Philodryas olfersii (Lichtenstein, 1823) attended at Restauração Hospital in Recife, State of Pernambuco, Brazil: case report (2010) Rev. Soc. Bras. Med. Trop., 43, pp. 336-338de Jesus Reis Rosa, L., Silva, G.A.A., Amaral-Filho, J., Glauzer-Silva, M., Cogo, J.C., Groppo, F.C., Oshima-Franco, Y., The inhibitory effect of Camellia sinensis extracts against the neuromuscular blockade of Crotalus durissus terrificus venom (2010) J. Venom Res., 1, pp. 1-7Ekins, B.R., Rollins, D.E., Duffy, D.P., Gregory, M.C., Standardized treatment of severe methanol poisoning with ethanol and hemodialysis (1985) West J. Med., 142, pp. 337-340Fernandes, J.B., Vargas, V.M., Mutagenic and antimutagenic potential of the medicinal plants M. laevigata and C. xanthocarpa (2003) Phytother. Res., 17, pp. 269-273Floriano, R.S., Nogueira, R.M.B., Sakate, M., Laposy, C.B., Pereira-da-Motta, Y., Sangiorgio, F., David, H.C., Nabas, J.M., Effect of Mikania glomerata (Asteraceae) leaf extract combined with anti-venom serum on experimental Crotalus durissus (Squamata: Viperidae) envenomation in rats (2009) Rev. Biol. Trop., 57, pp. 929-937Ginsborg, B.L., Warriner, J., The isolated chick biventer cervicis nerve muscle preparation (1960) Br. J. Pharmacol. Chemother., 15, pp. 410-411Habtemariam, S., Harvey, A.L., Waterman, P.G., The muscle relaxant properties of Portulaca oleracea are associated with high concentrations of potassium ions (1993) J. Ethnopharmacol., 40, pp. 195-200Heluany, N.F., Homsi-Brandeburgo, M.I., Giglio, J.R., Prado-Franceschi, J., Rodrigues-Simioni, L., Effects induced by bothropstoxin, a component from Bothrops jararacussu snake venom on mouse and chick muscle preparations (1992) Toxicon, 30, pp. 1203-1210Kelic, S., Olsson, T., Kristensson, K., Interferon-gamma promotes proliferation of rat skeletal muscle cells in vitro and alters their AChR distribution (1993) J. Neurol. Sci., 114, pp. 62-67Kuru, S., Inukai, A., Kato, T., Liang, Y., Kimura, G., Sobue, G., Expression of tumor necrosis factor-alpha in regenerating muscle fibers in inflammatory and non-inflammatory myopathies (2003) Acta Neuropathol., 105, pp. 217-224Leite, P.T., Kaefer, I.L., Cechin, S.Z., Diet of Philodryas olfersii (Serpentes, Colubridae) during hydroelectric dam flooding in southern Brazil (2009) North-Western J. Zool., 5, pp. 53-60Lis-Balchin, L., Hart, S.L., Deans, S.G., Pharmacological and antimicrobial studies on different tea-tree oils (Melaleuca alternifolia, Leptospermum scoparium or Manuka and Kunzea ericoides or Kanuka), originating in Australia and New Zealand (2000) Phytother. Res., 14, pp. 623-629Maiorano, V.A., Marcussi, S., Daher, M.A.F., Oliveira, C.Z., Couto, L.B., Gomes, O.A., França, S.C., Pereira, P.S., Antiophidian properties of the aqueous extract of Mikania glomerata (2005) J. Ethnopharmacol., 102, pp. 364-370Mantegazza, R., Hughes, S.M., Mitchell, D., Travis, M., Steinman, L., Modulation of MHC class II antigen expression in human myoblasts after treatment with IFN-gamma (1991) Neurology, 41, pp. 1128-1132Martz, W., Plants with a reputation against snakebite (1992) Toxicon, 30, pp. 1131-1142Mise, Y.F., Casais-e-Silva, L.L., Lira-da-Silva, R.M., Ação protetora da Calendula officinalis (AsteraceaeCompositae) sobre a atividade miotóxica do veneno de Bothrops leucurus (SerpentesViperidae) (2009) Gaz. Med. Bahia, 79 (SUPPL. 1), pp. 50-55Mors, W.B., Nascimento, M.C., Parente, J.P., Da-Silva, M.H., Melo, P.A., Suarez-Kurtz, G., Neutralization of lethal and myotoxic activities of South American rattlesnake venom by extracts and constituents of the plant Eclipta prostata (Asteraceae) (1989) Toxicon, 27, pp. 1003-1009Nandakumar, N.V., Pagala, M.K.D., Venkatachari, S.A.R., Namba, T., Grob, D., Effect of Cleistanthus collinus leaf extract on neuromuscular function of the isolated mouse phrenic nerve-diaphragm (1989) Toxicon, 27, pp. 1219-1228Nazato, V.S., Rubem-Mauro, L., Vieira, N.A.G., Rocha-Júnior, D.S., Silva, M.G., Lopes, P.S., Dal Belo, C.A., Oshima-Franco, Y., In vitro antiophidian properties of Dipteryx alata Vogel bark extracts (2010) Molecules, 15, pp. 5956-5970Nirthanan, S., Charpantier, E., Gopalakrishnakone, P., Gwee, M.C.E., Khoo, H.E., Cheah, L.S., Kini, R.M., Bertrand, D., Neuromuscular effects of candoxin, a novel toxin from the venom of the Malayan krait (Bungarus candidus) (2003) Br. J. Pharmacol., 139, pp. 832-844Nopimoga, M.H., Yatsuda, R., Scientific evidence for Mikania laevigata and Mikania glomerata as a pharmacological tool (2010) J. Pharm. Pharmacol., 62, pp. 809-820Núñez, V., Otero, R., Barona, J., Fonnegra, R., Jiménez, S., Osório, R.G., Quintana, J.C., Díaz, A., Inhibition of the toxic effects of Lachesis muta, Crotalus durissus cumanensis and Micrurus mipartitus snake venoms by plant extracts (2004) Pharmacol. Biol., 42, pp. 49-54Oshima-Franco, Y., Alves, C.M.V., Andréo-Filho, N., Gerenutti, M., Cintra, A.C.O., Leite, G.B., Rodrigues-Simioni, L., Silva, M.G., Neutralization of the neuromuscular activity of bothropstoxin-I, a myotoxin from Bothrops jararacussu snake venom, by a hydroalcoholic extract of Casearia sylvestris Sw. (guaçatonga) (2005) J. Venom. Anim. Toxins Incl. Trop. Dis., 11, pp. 465-478Oshima, M., Leite, G.B., Rostelato-Ferreira, S., da Cruz-Höfling, M.A., Rodrigues-Simioni, L., Oshima-Franco, Y., Insights of the effects of polyethylene glycol 400 on mammalian and avian nerve terminals (2010) Muscle Nerve, 41, pp. 540-546Oshima-Franco, Y., Rosa, L.J.R., Silva, G.A.A., Amaral Filho, J., Silva, M.G., Lopes, P.S., Cogo, J.C., da Cruz-Höfling, M.A., Antibothropic action of Camellia sinensis extract against the neuromuscular blockade by Bothrops jararacussu snake venom ant its main toxin, bothropstoxin-I (2012) Pharmacol. Intech, CroatiaOtero, R., Núñez, V., Barona, J., Fonnegra, R., Jiménez, S.L., Osório, R.G., Saldarriaga, M., Diaz, A., Snakebites and ethnobotany in the northwest region of Colombia: Part III: neutralization of the haemorrhagic effect of Bothrops atrox venom (2000) J. Ethnopharmacol., 1, pp. 233-241Prado-Franceschi, J., Hyslop, S., Cogo, J.C., Andrade, A.L., Assakura, M.T., Cruz-Höfling, M.A., Rodrigues-Simioni, L., The effects of Duvernoy's gland secretion from the xenodontine colubrid Philodryas olfersii on striated muscle and the neuromuscular junction: partial characterization of a neuromuscular fraction (1996) Toxicon, 34, pp. 459-466Prado-Franceschi, J., Hyslop, S., Cogo, J.C., Andrade, A.L., Assakura, M.T., Reichl, A.P., Cruz-Höfling, M.A., Rodrigues-Simioni, L., Characterization of a myotoxin from the Duvernoy's gland secretion of the xenodontine colubrid Philodryas olfersii (green snake): effects on striated muscle and neuromuscular junction (1998) Toxicon, 36, pp. 1407-1421Ribeiro, L.A., Puorto, G., Jorge, M.T., Bites by the colubrid snake Philodryas olfersii: a clinical and epidemiological study of 43 cases (1999) Toxicon, 37, pp. 943-948Ridtitid, W., Rattanaprom, W., Thaina, P., Chittrakarn, S., Sunbhanich, M., Neuromuscular blocking activity of methanolic extract of Piper sarmentosum leaves in rat phrenic nerve-diaphragm preparation (1998) J. Ethnopharmacol., 61, pp. 135-142Rocha, M.M.T., Furtado, M.F.D., Análise das atividades biológicas dos venenos de Philodryas olfersii (Lichtenstein) e P. patagoniensis (Girard) (Serpentes, Colubridae) (2007) Rev. Bras. Zool., 24, pp. 410-418Rocha, M.M.T., Paixão-Cavalcante, D., Tambourgi, D.C., Furtado, M.F.D., Duvernoy's gland secretion of Philodryas olfersii and Philodryas patagoniensis (Colubridae): neutralization of local and systemic effects by commercial bothropic antivenom (Bothrops genus) (2006) Toxicon, 47, pp. 95-103Rocha, T., de Barros, L.L., Fontana, K., de Souza, B.M., Palmas, M.S., Cruz-Höfling, M.A., Inflammation and apoptosis induced by mastoparan Polybia-MPII on skeletal muscle (2010) Toxicon, 55, pp. 1213-1221Salgado, H.R.N., Roncari, A.F.F., Moreira, R.R.D., Antidiarrhoeal effects of Mikania glomerata Spreng. (Asteraceae) leaf extract in mice (2005) Rev. Bras. Farmacog., 15, pp. 205-208Salomão, E.L., Di-Bernardo, M., Philodryas olfersii: uma cobra comum que mata. Caso registrado na área da 8 a Delegacia Regional de Saúde (1995) Arq. Soc. Zool. Bras., p. 21Sharma, R., Anker, S.D., Cytokines, apoptosis and cachexia: the potential for TNF antagonism (2002) Int. J. Cardiol., 85, pp. 161-171Silinsky, E.M., Adenosine decreases both presynaptic calcium currents and neurotransmitter release at the mouse neuromuscular junction (2004) J. Physiol., 558, pp. 389-401Searl, T.J., Silinsky, E.M., The mechanism for prejunctional enhancement of neuromuscular transmission by ethanol in the mouse (2010) J. Pharmacol. Exp. Ther., 335, pp. 465-471Silva, M.V., Buononato, M.A., Relato clínico de envenenamento humano por Philodryas olfersii (1983) Mem. Inst. Butantan., pp. 121-126Soares de Moura, R., Costa, S.S., Jansen, J.M., Silva, C.A., Lopes, C.S., Bernardo-Filho, M., Nascimento-da-Silva, V., Carvalho, L.C.R.M., Bronchodilator activity of Mikania glomerata Sprengel on human bronchi and guinea-pig trachea (2002) J. Pharmac. Pharmacol., 54, pp. 249-256Suyenaga, E.S., Reche, E., Farias, F.M., Schapoval, E.E., Chaves, C.G., Henriques, A.T., Anti-inflammatory investigation of some species of Mikania (2002) Phytother Res., 16, pp. 519-523Tomita, Y., Hasegawa, S., Multiple effects of interferon on myogenesis in chicken myoblast cultures (1984) Biochim. Biophys. Acta, 804, pp. 370-37
Going Beyond Counting First Authors in Author Co-citation Analysis
Full text linkThe present study examines one of the fundamental aspects of author co-citation analysis (ACA) - the way co-citation
counts are defined. Co-citation counting provides the data on which all subsequent statistical analyses and mappings
are based, and we compare ACA results based on two different types of co-citation counting - the traditional type that
only counts the first one among a cited work's authors on the one hand and a non-traditional type that takes into
account the first 5 authors of a cited work on the other hand. Results indicate that the picture produced through this non-traditional author co-citation counting contains more coherent author groups and is therefore considerably clearer. However, this picture represents fewer specialties in the research field being studied than that produced through the traditional first-author co-citation counting when the same number of top-ranked authors is selected and analyzed. Reasons for these effects are discussed
Variations on the Author
Full text link“Variations on the Author” discusses two of Eduardo Coutinho’s recent films (Um Dia na Vida, from 2010, and Últimas Conversas, posthumously released in 2015) and their contribution to the general question of documentary authorship. The director’s filmography is characterized by a consistent yet self-effacing form of authorial self-inscription: Coutinho often features as an interviewer that rather than express opinions propels discourses; an interviewer that is good at listening. This mode of self-inscription characterizes him as an author who is not expressive but who is nonetheless markedly present on the screen. In Um Dia na Vida, however, Coutinho is completely absent form the image, while Últimas Conversas, on the contrary, includes a confessional prologue that moves the director from the margins to the center of his films. This article examines the ways in which these works stand out in the filmography of a director who offers new insights into the notion of cinematic authorship
Appropriate Similarity Measures for Author Cocitation Analysis
Full text linkWe provide a number of new insights into the methodological discussion about author cocitation analysis. We first argue that the use of the Pearson correlation for measuring the similarity between authors’ cocitation profiles is not very satisfactory. We then discuss what kind of similarity measures may be used as an alternative to the Pearson correlation. We consider three similarity measures in particular. One is the well-known cosine. The other two similarity measures have not been used before in the bibliometric literature. Finally, we show by means of an example that our findings have a high practical relevance.information science;Pearson correlation;cosine;similarity measure;author cocitation analysis
- …
