1,720,995 research outputs found
Going Beyond Counting First Authors in Author Co-citation Analysis
The present study examines one of the fundamental aspects of author co-citation analysis (ACA) - the way co-citation
counts are defined. Co-citation counting provides the data on which all subsequent statistical analyses and mappings
are based, and we compare ACA results based on two different types of co-citation counting - the traditional type that
only counts the first one among a cited work's authors on the one hand and a non-traditional type that takes into
account the first 5 authors of a cited work on the other hand. Results indicate that the picture produced through this non-traditional author co-citation counting contains more coherent author groups and is therefore considerably clearer. However, this picture represents fewer specialties in the research field being studied than that produced through the traditional first-author co-citation counting when the same number of top-ranked authors is selected and analyzed. Reasons for these effects are discussed
PEMBUATAN GELATIN DARI CAMPURAN KULIT IKAN GABUS DAN α KASEIN DENGAN METODE EKSTRASI VARIASI WAKTU PERENDAMAN DAN PELARUT
CahyoSasmito, 2020, 68Halaman, Tabel, Gambar, 4 Lampiran
Di Sumatera Selatan ikangabusdimanfaatkanolehindustrikerupuk, kemplangdanpempek. Padaikangabus, 30% nyamerupakanlimbahberupakulitdantulang. Potensikulitikangabussebagaisumberalternatifkolagendapatmenjadisolusidalampembuatangelatin yang amanuntukkalanganmasyarakat. Penelitianinibertujuanuntukmenentukanpengaruhvariasiterhadapkualitasdandapatkankondisi optimal untukpembuatangelatinberdasarkanvariasiwaktuperendamandanvariasipelarut. Metodepadapenelitianinidilakukandengantigatahapanyaknitahapanawalpembuatangelatindenganekstraksi, tahapankeduapembuatancasein darisususapimurni, dantahapanterakhirpencampurangelatindengancasein. Padatahapawaldigunakan proses perlakuanberbedadenganvariasirasiowaktuperendamanyaitu 12, 24, 36, dan 48 jam, sertavariasipelarutHCldan H2SO4. Hasilanalisadiamatiadalahrendemen,organoleptik, kadar air, kadarabu, pH, kekuatan gel, viskositasdankadar protein. Hasilpenelitianmenunjukkanbahwagelatin yang telahdicampurkaseindaripenelitianmenghasilkankadar air 4,28-12,90 %, kadarabu 1,77-9,27% pH 5,5-4, viskositas 12,58-15,72 cPs, kadar protein 53,27 – 86,18 % dankekuatan gel 217,57499,13 bloom sertahasilpengujianorganoleptikberupawarnakuningpucat,kremdanabumuda. Hasildaripenelitiankondisi optimum dariinteraksivariabel yang digunakanuntukmembuatgelatinyaitupadaanalisaviskositasphdankekuatan gel adalahwaktu 48 jam danpelarutHCluntukviskositaspelarut yang optimum adalah H2SO4 sedangkananalisakadarabu, kadar air, rendemendan protein waktuperendamannya 36 jam denganpelarutHCluntuk protein dankadarabupelarut yang optimum adalah H2SO
ANALISIS PENGARUH KOMPENSASI, PENDIDIKAN DAN PELATIHAN, SERTA MOTIVASI TERHADAP KINERJA PEGAWAI PADA DINAS KOPERASI, PERINDUSTRIAN DAN PERDAGANGAN KABUPATEN SOPPENG
Evaluation Working performance of The Cooperation, Industry and Trade Board of Soppeng Regency has not reached to what expected by Soppeng’s community. This seemed to due to several factors such as compensation, edication and training, and motivation the employees. this study was aimed to describe the effects of compensation, education & training, and motivation on employee’s working performance of The Cooperation, Industry and Trade Board of Soppeng Regency. This study was conducted at the The Cooperation, Industry and Trade Board of Soppeng Regency from August 2012 to December 2012. All 38 employees of the board were used as respondents. Primary data were directly collected from respondents sing questionaires to obtained information related to compensation, education and training and motivation (as dependent variables), and employee’s working performance (as in independent variable). Data analyses covered validity and realibility of instruments and a linier regression. Results of this study showed that compensation, education and training and motivation simulatenously affected employee’s working performance of The Cooperation, Industry and Trade Board of Soppeng Regency. These three independent variables contrubuted 73,7% variation of the dependent variable (working performance). Partially, compensation and education and tranining significantly affected working performance whereas motivation did not significantly affect working performance. Education and training seemed to be the dominant factor affecting working performance of employees of The Cooperation, Industry and Trade Board of Soppeng Regency
Variations on the Author
“Variations on the Author” discusses two of Eduardo Coutinho’s recent films (Um Dia na Vida, from 2010, and Últimas Conversas, posthumously released in 2015) and their contribution to the general question of documentary authorship. The director’s filmography is characterized by a consistent yet self-effacing form of authorial self-inscription: Coutinho often features as an interviewer that rather than express opinions propels discourses; an interviewer that is good at listening. This mode of self-inscription characterizes him as an author who is not expressive but who is nonetheless markedly present on the screen. In Um Dia na Vida, however, Coutinho is completely absent form the image, while Últimas Conversas, on the contrary, includes a confessional prologue that moves the director from the margins to the center of his films. This article examines the ways in which these works stand out in the filmography of a director who offers new insights into the notion of cinematic authorship
Appropriate Similarity Measures for Author Cocitation Analysis
We provide a number of new insights into the methodological discussion about author cocitation analysis. We first argue that the use of the Pearson correlation for measuring the similarity between authors’ cocitation profiles is not very satisfactory. We then discuss what kind of similarity measures may be used as an alternative to the Pearson correlation. We consider three similarity measures in particular. One is the well-known cosine. The other two similarity measures have not been used before in the bibliometric literature. Finally, we show by means of an example that our findings have a high practical relevance.information science;Pearson correlation;cosine;similarity measure;author cocitation analysis
Dispelling the Myths Behind First-author Citation Counts
We conducted a full-scale evaluative citation analysis study of scholars in the XML research field to explore just how different from each other author rankings resulting from different citation counting methods actually are, and to demonstrate the capability of emerging data and tools on the Web in supporting more realistic citation counting methods. Our results contest some common arguments for the continued
use of first-author citation counts in the evaluation of scholars, such as high correlations between author rankings by first-author citation counts and other citation
counting methods, and high costs of using more realistic citation counting methods that are not well-supported by the ISI databases. It is argued that increasingly available digital full text research papers make it possible for citation analysis studies to go beyond what the ISI databases have directly supported and to employ more
sophisticated methods
koamabayili/VECTRON-author-checklist: VECTRON author checklist
We have done our best to complete the author checklist relating to the use of animals in the hut study. Note that the objective for the hut study was to evaluate the IRS treatment applications for residual efficacy against Anopheles mosquitoes, including the local An. coluzzii mosquito population. Cows were only used to attract mosquitoes into the huts and no tests were carried out directly on the cows. The author checklist is intended for use with studies where experiments are carried out on animals, which is why we have had such difficulty in completing this for the hut study, as many of the questions do not relate to how the cows were used
Author-wise bibliometric analysis based on entropy.
Author-wise bibliometric analysis based on entropy.</p
- …
