Saint Louis University

Saint Louis University Libraries Digital Collections
Not a member yet
    46011 research outputs found

    Universitas: the magazine of Saint Louis University

    No full text
    Summmer 2021 issue of Universitas: the magazine of Saint Louis University.REMEMBERING DR. SMITH Page 11 CHESS GRANDMASTER Page 21 CORE CURRICULUM Page 24 NEW HOSPITAL Page 26 SEE WHAT GOES ON INSIDE THE NEW INTERDISCIPLINARY SCIENCE AND ENGINEERING BUILDING Page 14 PRESIDENT’S MESSAGE VOLUME 47, ISSUE 2 EDITOR Laura Geiser {A&S ’90, Grad ’92} ASSOCIATE EDITOR Amy Garland {A&S ’97} ART DIRECTOR Matt Krob CONTRIBUTORS Clayton Berry Marie Dilg {Grad SW ’94} Maggie Rotermund Maria Tsikalas ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER The Interdisciplinary Science and Engineering Building Photo by Steve Dolan Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to: Universitas DuBourg Hall 39 1 N. Grand Blvd. St. Louis, MO 63103 We accept email at: [email protected] Website: slu.edu/universitas Universitas is printed by Breese Printing and Publishing Worldwide circulation: 129,296 © 2021, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. Features Departments 11 REMEMBERING A VISIONARY Reflections on the life and legacy of Dr. Jonathan Smith, SLU’s chief diversity officer. — By Clayton Berry 14 DESIGNED FOR DISCOVERY The new Interdisciplinary Science and Engineering Building is a research hub. — By Marie Dilg 21 CHESS QUEEN Student Dorsa Derakhshani came from Iran for a game and for a degree. — By Amy Garland 24 SIGNATURE EXPERIENCE SLU has mapped out its first University-wide core curriculum. — By Marie Dilg 26 GRAND NEW See the new SSM Health SLU Hospital and Center for Specialized Medicine. 2 ON CAMPUS Success amid the pandemic /// New provost /// Commencement /// Jesuit Center /// Campaign update /// Rankings news /// Women’s soccer /// Ignatian Year 30 CLASS NOTES 31 HOW I GOT HERE Erin Loos Cutraro {Grad A&S ’02} 32 ALUMNI SPOTLIGHT Dana J. Boente {CSB ’76, Grad CSB ’77, Law ’82} 34 IN MEMORIAM 36 LETTERS TO THE EDITOR 37 THE LAST LOOK The entry atrium of the Interdisciplinary Science and Engineering building photographed from the third floor. For more on the research that goes on inside the ISE, see the story on page 14. PHOTO BY DOUGLAS GARFIELD Through relentless planning of our campus experts and superb execution across our University, we were able to continue to advance knowledge, edu-cate students and serve patients with the excellence and compassion for which we are known. I am sure that you, like me, could not be prouder of how of the SLU faculty, staff and students continued to serve our mission and advance our vision amidst the severe disruption of the pandemic. In this issue of Universitas, we feature a few of the many successes of the past year, including the opening of the new Interdisciplinary Science and Engineering Building (page 14). We also report on some of those new to the University or moving into new positions, such as our provost, Dr. Mike Lewis, who is working to take SLU to new heights in academic success and as a preeminent research university (page 4). Sadly, days before this issue was going to press, we learned the devastating news of the passing of our beloved vice president for diversity and community engagement. Dr. Jonathan Smith was always working to make things as they We have had a remarkable year here at Saint Louis University. Amidst one of the greatest challenges in our lifetime — the COVID-19 pandemic — we persevered and succeeded thanks to the adaptability, hard work and compliance with COVID protocols displayed by the staff, faculty and students of SLU. PHOTO BY STEVE DOLAN ought to be. The grieving SLU community came together to host a memorial service that attracted Jonathan’s fam-ily, friends and colleagues from across the country. One consistent theme of the service was that Jonathan’s work is far from finished. It is up to those of us who remain to con-tinue to advance the initiatives to which he devoted his life. As the summer begins to draw to a close and we prepare to welcome one of the largest entering classes of students in our 203-year history, I want to express my appreciation to all of you who wrote and called in support of our efforts and decisions to navigate the complexities and challenges of the past year. May God bless you and Saint Louis University. Dr. Fred P. Pestello President 2 UNIVERSITAS THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y ON CAMPUS SUMMER 2021 3 SLU Successfully Completes Academic Year Amid Pandemic Saint Louis University successfully wrapped up its 2020-21 academic year — one that brought unprecedented challenges due to a global pandemic — without having to suspend its commitment to mostly in-person classes, entirely in-person labs and on-campus living. “Every member of our Saint Louis University community should be proud of all we have accomplished this past year, much of which many thought impossible a year ago,” said University President Dr. Fred P. Pestello. “The pandemic tested us, and we pulled together and rose to the challenges as One SLU.” Pestello continued: “I have heard from many students and parents about how well SLU communicated with them and how positive it was to them that we kept our campus open and taught primarily in person.” But why was SLU able to keep its campus open at a time when other colleges across the country were being forced to shelter in place, sus-pend in-person classes or move completely online? Among many other factors, University officials point to a decision early in the crisis to engage SLU’s experts and solicit them to lead the University’s response to COVID-19, including three uniquely qualified faculty members: Dr. Terri Rebmann (Grad VSN ’06), professor of epidemiology and biostatistics, and director of SLU’s Institute for Biosecurity, served as a special assis-tant to the president with overarching authority on all matters related to COVID-19. Rebmann has been at the center of the University’s integrated COVID-prevention team. Dr. Rachel Charney, professor of pediatric emer-gency medicine and director of disaster preparedness for SLU’s School of Medicine and SLUCare, directed the University’s contact tracing program. The team’s quick work prevented extensive community spread as approximately 40 percent of quarantined students ultimately tested positive for COVID. Deborah Horton (Grad VSN, PH ’09), assistant professor of nursing and expert on disaster prepared-ness in schools, directed SLU’s weekly asymptomatic testing program, which conducted more than 22,000 COVID-19 tes t s . She a l so has over seen the University’s state-authorized vaccine clinics, which have vaccinated more than 13,300 people to date. The three experts agree SLU was well positioned to succeed in the fight against COVID-19 as a Jesuit research university with medical, nursing, physician assistant, and public health schools and programs, as well as its own physician practice. “We have expertise at Saint Louis University that is just not avail-able at other universities,” said Rebmann, who also coordinated weekly meetings of area college officials and local health department leaders. “And we worked together as a team to address what we needed,” added Charney, who helped organize similar sessions among the region’s health systems. “We used our own strengths to support each other, which I think was awesome.” And one of those strengths was the commitment of students to do their part. Beyond complying with SLU’s stringent public health safe-guards, students contributed in many other ways. Chief among them: Students from SLU’s Trudy Busch Valentine School of Nursing conducted weekly asymptomatic tests and staffed on-campus vaccination clinics. Physician assistant students from SLU’s Doisy College of Health Sciences also administered vaccinations. Graduate students in the University’s College for Public Health and Social Justice served as the primary members of SLU’s contact tracing team. Students from many majors conducted audits for compliance with campus safeguards and provided peer education as part of a Public Health Ambassadors program unique to SLU. Students volunteered to deliver meals to their fellow Billikens in iso-lation and quarantine housing, while Campus Ministry interns made them care packages. “There were many students throughout the University who helped provide whatever support we needed,” said Horton, who also helped organized vaccine clinics for parishioners from area churches and local refugees, among others. RESPONDING AS ONESLU In keeping with the OneSLU spirit, winning the battle against COVID-19 required the hard work and dedication of every member of the University community. Key efforts included: Essential personnel reporting to work daily to keep the campus open; faculty managing face-to-face and online instruction simultaneously; and staff working remotely to help “de-densify” the campus. Improving ventilation and filtration systems in buildings, installing hundreds of touchless hand sanitizers in common areas, reconfig-uring event spaces for use as classrooms and following enhanced cleaning protocols recommended by the CDC. Rapidly deploying new technologies to enable remote learning and working, launching the symptom-checking app #CampusClear and increasing on-site technical support. Developing a detailed housing plan — approved by the city’s health authorities — that allowed SLU to safely accommodate all students who wanted to live on campus. PREPARING FOR FALL 2021 Planning for as normal a fall semester as possible — operating largely face to face with full classrooms and labs, on-campus liv-ing and in-person events — SLU announced in June that it will require COVID-19 vaccinations for all students, staff and faculty who are phys-ically present on the St. Louis campus. The requirement also applies to students from the St. Louis campus studying abroad, including SLU-Madrid. Recommended by a group of faculty, staff and students, SLU’s vac-cine requirement aligns with the latest guidance issued by the CDC that states that institutions of higher education where all faculty, staff and students are fully vaccinated can return to normal, full-capacity opera-tions. To date, nearly 600 U.S. colleges and universities have announced vaccine requirements for their campuses. —By Clayton Berry PHOTO BY STEVE DOLAN SLU RESPONDS TO COVID-19 SLU’s first large-scale COVID-19 vaccination event at Simon Recreation Center in March. Additional clinics were held on campus throughout the spring. Volunteers, including undergraduate students, from the Trudy Busch Valentine School of Nursing and SLU’s physician assistant program worked the clinics. Non-clinical volunteers from departments across campus staffed the registration tables and assisted with scheduling second-dose appointments. 70-80% Approximate percentage of SLU classes this academic year that were fully or primarily in person. 3,500+ Students who lived on campus — of SLU’s 12,000-person student body. SLU reduced its housing occupancy by about 10% in a plan approved by city health officials. 0 Documented cases of disease transmission in SLU classrooms, lab spaces or other educational settings. 40,000+ Doses of vaccine stored on campus for the Missouri National Guard to support mass vaccination efforts in the region. 150+ Updates sent to the SLU community from University leaders since the crisis began last year. Communication was a priority during the pandemic. By the Numbers A member of the SLU community receives a COVID-19 vaccination from nursing student Sarah Litzsinger (RIGHT) at Simon Recreation Center. PHOTO BY STEVE DOLAN 4 UNIVERSITAS THE ALUMNI MAGA ZINE OF SAINT LOUI S UNIVERS I T Y SUMMER 2021 5 ON CAMPUS RANKINGS ATHLETICS SLU Graduate, Professional Programs Again Among Nation’s Best in U.S. News Rankings Saint Louis University has 25 graduate and professional programs ranked in the top 100 in the 2022 edition of U.S. News & World Report’s “America’s Best Graduate Schools” guide, which was released in March. The School of Law’s health law program was named No. 2 in the country, continuing a long tradition of holding a top spot since rankings for the discipline were first published nearly 20 years ago. A dozen other SLU law programs were ranked in the top 100 as well, including clinical training, which improved 30 spots to No. 56. Several graduate programs at SLU rose in the U.S. News rankings this year, including the Master of Science in Nursing program, which climbed 18 spots into the nation’s top 50 among more than 500 nursing graduate programs. Rankings for the School of Medicine also improved this year. Among the more than 150 accredited M.D. programs in the United States, SLU ranked No. 46 for primary care and No. 70 for research. The data for the rankings came from statistical surveys of more than 2,125 programs and reputation surveys sent to more than 23,000 academics and professionals, conducted in fall 2020 and early 2021. SLU’s Top 50 U.S. News Graduate Rankings for 2022 BUSINESS 9 International 14 Entrepreneurship 16 Supply Chain LAW 2 Health Care 31 Law - Part Time HEALTH AND MEDICINE 46 Medical Schools - Primary Care 48 Nursing Schools - Master’s NOTE: U.S. News & World Report does not re-rank all graduate programs every year; some disciplines are ranked on four- or six-year cycles. More Recent Rankings Saint Louis University made The Princeton Review’s list of Best Value Colleges for 2021 and was ranked No. 10 on its list of the Top 20 (Private) Schools for Making an Impact — the only Jesuit university on that list. SLU ranks No. 8 on The Wall Street Journal’s 2021 list of the top 10 colleges in big Midwestern cities. The Wall Street Journal/Times Higher Education College Rankings also put SLU No. 6 among the top 10 Catholic universities in the country, a placement SLU has held for multiple years. Niche ranked the Trudy Busch Valentine School of Nursing as the No. 8 best college in the country for nursing. College Consensus ranked SLU as the No. 9 best Catholic college in the country with online degree programs and No. 24 overall. The site called SLU “one of the most respected Catholic universities in the nation.” SLU ranks No. 22 on Intelligent.com’s list of the top Project Management Degree programs for 2021. SLU’s Bachelor of Science in Project Management was recognized for Best Accelerated Program. College Factual ranked the College for Public Health and Social Justice as the No. 1 undergraduate public health program in the Plains States region and 27th in the nation. The site’s ranking analyzed 105 colleges and universities that offer a bachelor’s degree in public health. Best Health Degrees named SLU’s radiation therapy program among the top 25 Best Radiation Science programs, ranking No. 8 in the nation. SLU’s Richard A. Chaifetz School of Business was recognized by Poets&Quants for Undergrads on its 2021 list of the top 100 programs for undergraduate business schools. SLU ranked No. 60 for outcomes and No. 72 overall in the nation. The Chaifetz School of Business was one of only two schools in Missouri to make this national ranking. Women’s Soccer Ends Winning Season at NCAA Tournament SLU’s women’s soccer team captured the A-10 Championship title in April, becoming the first women’s soccer team in conference history to capture both regular-season and tournament titles in three consecutive seasons. The team secured an automatic bid and was the No. 15 seed in this year’s NCAA Women’s Soccer Championship, marking its third consecutive appearance in the championship and fifth in program history. SLU earned a first-round bye in the NCAA Championship, which was reduced from the customary 64 teams to 48, with the top 16 teams seeded into the second round. Unfortunately, the Billikens were eliminated in penalty kicks following a 0-0 tie with the Washington Huskies. The Billikens went into the national tournament on the heels of a 10-game winning streak, having outscored its opponents 40-9 this season. PHOTO BY BILL BARRETT The women’s soccer team celebrates. FROM LEFT: Karsen Kohl, Hannah Friedrich, Abbie Miller, Emily Groark and Hannah Larson Lewis Named Permanent Provost In Feburary, Dr. Michael Lewis was appointed permanent provost of Saint Louis University. The appointment followed a national search that began in August 2020. The provost serves as the University’s chief academic officer. In addition to academic oversight, the divisions of Enrollment and Retention Management, Research, and Student Development, and the Office of Diversity and Community Engagement all report to the provost. Lewis had been SLU’s interim provost since July 2020. Prior to that appointment he served as interim dean of the College of Arts and Sciences for the 2019-20 academic year, and as acting provost from August 2018 to January 2019. In 2013, he began serving as associate provost, overseeing the University’s Office of Faculty Affairs. He has been a member of the chemistry faculty since 2004. “I strongly believe Mike is the best person for the job. He is a trusted leader and a person who can dive right in immediately, without the need for a lengthy period of acclimation and trust-building with faculty, staff and students,” said University President Dr. Fred P. Pestello. “He has a deep commitment to our Catholic, Jesuit mission and will be a champion for enhancing the diversity, equity and inclusion on our campuses and in our community.” “It is humbling to be named SLU’s permanent provost,” Lewis said. “I have been a member of the community for nearly 17 years, and I know the amazing capabilities of our faculty and staff. “I understand the incredible talents of our students and the transformative nature of a SLU education,” he continued. “I am thrilled to continue working with this community, enhancing our educational experience, expanding the impact of our research and scholarship, and leading with fidelity to our Jesuit mission as we seek to embody equity and justice at SLU and throughout the St. Louis region.” Lewis said one of his top priorities will be working with the deans and faculty on development of an academic strategic plan for the University. He also is committed to continuing his leadership of pressing and complex academic issues, including: unit resource disparities, recruitment and retention of faculty of color, implementation of the new core curriculum, faculty workload disparities, academic portfolio review, and minority student success and retention throughout the University. “We need to address diversity, equity and inclusion at SLU, and this will be a long-term priority,” Lewis said. In a message to the SLU community at the time of his appointment, Lewis expanded on his goals. “Our new University core needs continued support, and we must assure the success of this fall’s pilot,” he said. “The attention to managing our resources more effectively and efficiently needs to remain a constant. And we must become more flexible and nimble in developing new ways to attract and enroll students.” In 2009, Lewis received the College of Arts and Sciences’ William V. Stauder, S.J., Award for Excellence in Teaching in the Natural Sciences. And from 2016-19, he received funding from the National Institutes of Health as a co-investigator on research to understand the thermodynamics and structure of RNA secondary structure motifs. Lewis Celebrate the Ignatian Year The International Association of Jesuit Universities has invited Jesuit institutions across the world to celebrate the Ignatian Year, which began on May 20 — the 500-year anniversary of the wounding of St. Ignatius Loyola during the Battle of Pamplona in 1521. During Ignatius’ recovery from that wound, he underwent a spiritual conversion and set out to establish the Society of Jesus. The resulting Jesuit spir-ituality and form of education have shaped millions of people over the past five centuries. “While this Ignatian Year encourages all of us to reflect upon what we have received through the inspi-ration of St. Ignatius, it also provides an opportunity to look forward to consider how the Jesuit works of a city or region like St. Louis might work together more closely, how we might more effectively promote the spirituality of St. Ignatius at Saint Louis University,” said David Suwalsky, S.J. (Grad A&S ’89, ’10), SLU’s vice president for mission and identity. Throughout the Ignatian Year, SLU will offer resources for alumni, students, faculty and staff to reflect upon the life of St. Ignatius and deepen their understanding of his spiritual legacy. The celebratory year will conclude on the Feast Day of St. Ignatius on July 31, 2022. GeoSLU Awarded 5MillionforTrainingProgramSaintLouisUniversitysGeospatialInstitute(GeoSLU)received5 Million for Training Program Saint Louis University’s Geospatial Institute (GeoSLU) received 5 million to train the Department of Defense and National Geospatial- Intelligence Agency (NGA) in geoinformatics and geospatial data sciences. Over the next five years, SLU faculty will teach a variety of subjects, including GIS mapping, remote sensing, data science, geospatial analytics, coding, artificial intelligence/machine learning and cyber-security, as a part of the NGA’s GEOINT Learning through Academic Programs. The agreement allows the existing workforce to be trained in these new technologies and methodologies. It also reaffirms GeoSLU’s role as a leader in geospatial training and continues to build St. Louis’

    Universitas: the magazine of Saint Louis University

    No full text
    Winter 2020 issue of Universitas: the magazine of Saint Louis University.Back to Campus: COVID-19 Edition STORIES FROM SLU’S SUCCESSFUL SEMESTER How SLU Responded: Page 10 Resident Expert: Page 26 CHIEF DIVERSITY OFFICER Page 18 REIMAGINING JUSTICE Page 24 ALUMNUS DR. ALEX GARZA Page 31 PRESIDENT’S MESSAGE In this issue, you will hear the stories of seven members of our campus commu-nity who share their experiences during the COVID-19 pandemic, navigating challenges and finding opportunities to thrive and serve. You will read about the remarkable work happening at Saint Louis University to address racial injustice on our campus, in the greater community and beyond. And you will meet some remark-able people along the way — people who live the mission of our resilient University. I am filled with pride about SLU when I read their stories, which reflect the every-day work and sacrifice of our faculty, clinicians, staff and students under current COVID-19 restrictions. It is important that each of us seek the things that bring us peace, joy and happiness amid the suffering and isolation caused by this raging pandemic. I can best explain what I try to do by sharing a tale that goes straight to the essence of our University. One of the best-known stories about the Jesuits is the story of the cannonball and the conversion of Iñigo Lopez de Loyola, better remembered as St. Ignatius Loyola. In 1521 during the Battle of Pamplona, Ignatius — a dashing soldier — was gravely wounded by a cannonball. This was devastating for the vain man from a wealthy family who lived the good life and would be called a playboy in today’s language. Bedridden for months, a bored Ignatius read the only two books around. One was a life of Christ and the other was a collection of stories about the saints. As Ignatius read, he came to admire the saints, yet, he continued to dream of returning to the life of fame and luxury. Over time he found, however, that he felt more satisfied and at peace when he contemplated the lives of the saints. His values began to change, and he was converted to a spiritual life dedicated to serving Christ — a simple life this man of privilege found to be more meaningful. This special issue of Universitas reminds us of how blessed we are to be part of a community of men and women who are truly for and with others. PHOTO BY DOUGLAS GARFIELD Pestello with his spouse, Dr. Fran Pestello, on campus in August This virus-imposed isolation has found many of us, me included, cut off from many routine pleasures — attending celebrations with family, dining out with friends, conversing with co-workers in person and traveling to faraway cities. My COVID-19-restricted life has led me to recon-sider what gives me the greatest pleasure and reflect upon what truly matters. I find joy in the much simpler pleasures of life — the beauty in nature and architec-ture in my Central West End neighborhood, nearby Forest Park and on our beautiful, urban campus; a glass of wine on the back patio; and meaningful con-versations with my spouse, Fran, and our family. As a person accustomed to working long days out of the house, rushing from one meeting or event to the next one, on and off campus, I have surprised myself by finding happiness in the slowing down and the rediscovery of the spiritual dimension of my life and work. I pray that you and your families have found and continue to find peace and joy during this time of sub-stantial social contraction. May God bless you, and may God continue to bless Saint Louis University. Dr. Fred P. Pestello President VOLUME 47, ISSUE 1 EDITOR Laura Geiser {A&S ’90, Grad ’92} ASSOCIATE EDITOR Amy Garland {A&S ’97} ART DIRECTOR Matt Krob CONTRIBUTOR Marie Dilg {Grad SW ’94} ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER Students near Lipic Clock Tower Plaza on the first day of classes, Aug. 17, 2020 Photo by Douglas Garfield Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to: Universitas DuBourg Hall 39 1 N. Grand Blvd. St. Louis, MO 63103 We accept email at: [email protected] Website: slu.edu/universitas Universitas is printed by Breese Printing and Publishing Worldwide circulation: 125,736 © 2021, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. Dr. Amber Johnson with a Justice Fleet truck. For more, see the story on page 24. Features Departments 10 HOW SLU RESPONDED Seven perspectives on success from SLU’s fall semester — By Laura Geiser 18 WORK IN PROGRESS A Q&A with SLU’s chief diversity officer, Dr. Jonathan Smith — By Amy Garland 24 REIMAGINING JUSTICE SLU social justice advocates work for change and equity. — By Marie Dilg 26 RESIDENT EXPERT SLU’s infectious disease specialist focuses on campus safety. — By Marie Dilg 2 ON CAMPUS ISE Building dedicated /// Vaccine trials /// Campaign milestone /// SSM SLU Hospital /// Rankings news /// E-transcripts /// Prospect Yards update 28 CLASS NOTES 31 HOW I GOT HERE Dr. Alexander G. Garza (Grad PH ’03) 34 IN MEMORIAM 36 LETTERS TO THE EDITOR 37 THE LAST LOOK PHOTO BY STEPHEN DOLAN 2 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y ON CAMPUS PHOTO BY KEVIN LOWDER At the ribbon-cutting for the ISE Building on Sept. 26: (from left) Jim Shaughnessy (CSB ’89) of BSI Constructors Inc.; Dr. Michael Lewis, interim provost; Chris Chivetta, president of Hastings+Chivetta architects; Paul Shaughnessy of BSI; Joseph Shaughnessy (IT ’57), co-founder of BSI; David Suwalsky, S.J, vice president for mission and identity; Joe Conran (A&S ’67, Law ’70), chairman of SLU’s board of trustees; Dr. Fred P. Pestello, SLU president; Dr. Michael Goldwasser, chair of the Department of Computer Science; Dr. Terra Edwards, assistant professor of sociology and anthropology; and Sophia Izhar, a biology major and member of the Student Government Association. WINTER 2021 | 3 PHOTO BY GARRETT CANDUCCI SLU Dedicates Interdisciplinary Science and Engineering Building Saint Louis University dedicated its newest academic building, the 50 million Interdisciplinary Science and Engineering (ISE) Building, during a virtual ceremony in September. The 90,000-square-foot, three-story structure opened in July. University President Dr. Fred P. Pestello said the building furthers SLU’s vision of being a global, Jesuit university — one that is mission-focused, student- and patient-centered, and research-driven; one that works with citizens in the region to reimagine, transform and unify St. Louis. The ISE Building features innovative teaching lab spaces for bioinformatics, biology, biomedical engineering, chemistry, neuroscience and computer science courses that support all science, engineering, nursing and health science majors. Pestello and others praised everyone involved in ensuring the building opened on time despite the COVID-19 pandemic, including designers Hastings+Chivetta, general contractor BSI Constructors Inc. and SLU’s Division of Facilities Services. 4 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y ON CAMPUS RANKINGS SLU Honored with Top Rankings Each fall, college rankings are released by organizations from U.S. News & World Report to Niche to the Princeton Review. Here are some of the latest rankings earned by Saint Louis University. U.S. News Best Colleges 2021 103 of all national universities, schools that “offer a full range of undergraduate majors, plus master’s and doctoral programs, and emphasize faculty research or award professional practice doctorates” 15 in INTERNATIONAL BUSINESS (UNDERGRADUATE) 36 in ENTREPRENEURSHIP (UNDERGRADUATE) 48 in “BEST VALUE SCHOOLS” 68 in “BEST COLLEGES FOR VETERANS” The Princeton Review Best 386 Colleges 2021 Edition 2 among the universities MOST ENGAGED IN COMMUNITY SERVICE 4 in “IMPACT SCHOOLS,” based on student responses about service opportunities, student government, sustainability efforts and on-campus student engagement 17 in “BEST COUNSELING SERVICES,” based on student assessments of campus services 34 in UNDERGRADUATE ENTREPRENEURSHIP Niche 2021 Best Colleges 8 among 164 CATHOLIC COLLEGES 8 in NURSING 10 in KINESIOLOGY AND PHYSICAL THERAPY 29 in PUBLIC HEALTH 39 in CRIMINAL JUSTICE 42 in SPORTS MANAGEMENT 45 in ACCOUNTING AND FINANCE SLU Conducts Two COVID-19 Vaccine Trials As the COVID-19 pandemic continues to take a toll worldwide, researchers at Saint Louis University’s Center for Vaccine Development enrolled participants in two different phase 3 clinical trials. The trials studied the effectiveness, safety and immune response generated by vaccines co-developed by scientists at Moderna and the National Institute of Allergy and Infectious Diseases (NIAID) Vaccine Research Center and by Janssen Pharmaceutical Cos. of Johnson & Johnson. In August, SLU’s vaccine center enrolled participants in the first study as part of a larger Moderna trial that involved 30,000 participants across the country. Participants received two injections, 28 days apart. The vaccine center began enrolling participants in the Janssen trial in December. This trial evaluated the safety and efficacy of a single vaccine dose of the Janssen investigational COVID-19 vaccine candidate. “Scientists around the country have been working tirelessly to develop a vaccine that is safe and protects against COVID-19,” said Dr. Sharon Frey, clinical director of SLU’s Center for Vaccine Development and principal investigator of both trials at SLU. “St. Louisans will play a key role in the historic effort to develop a COVID-19 vac-cine,” Frey said. “It’s important that we study the vaccine for all people, including healthy people, those with underlying conditions, people over 60, as well as those who are younger and people of all races and ethnicities.” For both trials, researchers evaluated the vaccines in adults 18 years and older who were randomly assigned to receive the vaccines or placebos. SLU’s Center for Vaccine Development is part of the NIAID-supported COVID-19 Prevention Network (CoVPN). The CoVPN is composed of existing NIAID-supported clinical research networks with infectious disease expertise and is designed for rapid and thorough evaluation of vaccine candidates and monoclonal antibodies for the prevention of COVID-19. Frey SLU Noted for COVID-19 Community Outreach SLU ranked No. 7 in the nation on Great Value Colleges’ list of the 30 U.S. col-leges excelling in community outreach. The ranking specifically highlighted the University’s continued commitment to service since the start of the COVID-19 pandemic. The ranking methodology reflects how colleges and universities have adapted their community support during the pandemic. PHOTO BY ELLEN HUTTI WINTER 2021 | 5 NEW DEANS AND ADMINISTRATORS Dr. Sarah Cunningham VICE PRESIDENT FOR STUDENT DEVELOPMENT Cunningham, who joined SLU on Feb. 15, came to SLU from Johns Hopkins University, where she was the assistant vice provost for student life strategy and policy. Previously, she served in student affairs leadership roles at the University of Chicago, University of Florida and George Mason University. Cunningham succeeded Dr. Debra Lohe, director of SLU’s Reinert Center for Transformative Teaching and Learning, who had served as interim vice president since December 2019. Dr. Barnali Gupta EDWARD JONES DEAN FOR THE RICHARD A. CHAIFETZ SCHOOL OF BUSINESS Before joining SLU in January, Gupta was associate dean for curriculum in the Farmer School of Business at Miami University of Ohio, where she was also the first female faculty member to hold the rank of full professor in Miami’s Department of Economics. She is an economist with a specialization in industrial organization and applied game theory. Gupta succeeded Dr. Scott Duellman, Alfred V. Dunkin Professor of Accounting and associate professor, who had served as interim dean since fall 2019. David Suwalsky, S.J. (Grad A&S ’89, ’10) VICE PRESIDENT FOR MISSION AND IDENTITY Suwalsky began his term in July 2020. Just prior to this appointment, he was chair of SLU’s Department of Theological Studies. He also previously served at SLU as the director of academic initiatives in the Office of Mission and Identity and as director of museums and galleries. He also was president of Jesuit High School in Sacramento, California, from 2011-2017. Suwalsky succeeded Chris Collins, S.J. (Grad A&S ’01). ACCELERATING EXCELLENCE FUNDRAISING CAMPAIGN REACHES MILESTONE Two years into its public phase, the University’s Accelerating Excellence fundraising campaign has reached another mile-stone, raising more than 400 million of the historic effort’s 500milliongoal.AcceleratingExcellence:TheCampaignforSaintLouisUniversityaimstopropelSLUtofurthernationalprominenceasaJesuitresearchuniversitythroughinvestmentinfivestrategicpriorities:scholarships,academicexcellence,businesseducation,healthsciencesandathletics.ThecampaignlauncheditspublicphaseinNovember2018.AcrossallschoolsandcollegesoftheUniversity,thesuccessofthecampaignhasenabledSLUtomakeinvestmentsinworldclassfaculty,leadingedgetechnologyandstateoftheartfacilities,saidSheilaManion,vicepresidentfordevelopment.Additionally,AcceleratingExcellencehasincreasedscholarships,providingaccesstoSLUsworldclasseducationtoevengreaternumbersofaccomplishedstudentsfromallsocioeconomicbackgrounds.Theseadvancementsenhanceacademicandresearchexcellence,meetmarketplacedemandandextendtheUniversitysinternationalreachtobuildonSLUslegacyasaleaderinhighereducation.Manionadded,Asacomprehensivecampaign,AcceleratingExcellenceslatestmilestoneisalsomadepossiblebyawidevarietyofalumnianddonors,whosegiftsofallsizescontributetotheeffortstotaldollarsraised.TheAcceleratingExcellenceCampaignisongoing.Formoreinformationortosupportthecampaign,visitslu.edu/campaignforslu.TOTALDOLLARSRAISEDTODATE500 million goal. Accelerating Excellence: The Campaign for Saint Louis University aims to propel SLU to further national prominence as a Jesuit research university through investment in five stra-tegic priorities: scholarships, academic excellence, business education, health sciences and athletics. The campaign launched its public phase in November 2018. “Across all schools and colleges of the University, the suc-cess of the campaign has enabled SLU to make investments in world-class faculty, leading-edge technology and state-of-the-art facilities,” said Sheila Manion, vice president for development. “Additionally, Accelerating Excellence has increased scholar-ships, providing access to SLU’s world-class education to even greater numbers of accomplished students from all socio-eco-nomic backgrounds. These advancements enhance academic and research excellence, meet marketplace demand and extend the University’s international reach to build on SLU’s legacy as a leader in higher education.” Manion added, “As a comprehensive campaign, Accelerating Excellence’s latest milestone is also made possible by a wide vari-ety of alumni and donors, whose gifts of all sizes contribute to the effort’s total dollars raised.” The Accelerating Excellence Campaign is ongoing. For more information or to support the campaign, visit slu.edu/ campaignforslu. TOTAL DOLLARS RAISED TO DATE 422,053,714 ACADEMIC EXCELLENCE 201,648,792SCHOLARSHIPS201,648,792 SCHOLARSHIPS 81,530,385 HEALTH SCIENCES 78,005,763BUSINESSEDUCATION78,005,763 BUSINESS EDUCATION 31,850,466 ATHLETICS 29,018,308DOLLARSRAISEDSOFARBYEACHCAMPAIGNPRIORITY46,630622111830011.19DONORSTOTHECAMPAIGNSCHOLARSHIPS/FELLOWSHIPSCREATEDSINCETHEBEGINNINGOFTHECAMPAIGN29,018,308 DOLLARS RAISED SO FAR BY EACH CAMPAIGN PRIORITY 46,630 62 21 118 300 11.19% DONORS TO THE CAMPAIGN SCHOLARSHIPS/ FELLOWSHIPS CREATED SINCE THE BEGINNING OF THE CAMPAIGN 1 MILLION+ GIFTS INCREASE IN UNIVERSITY’S ENDOWMENT SINCE THE BEGINNING OF THE CAMPAIGN (AS OF JUNE 30, 2020) ENDOWED CHAIRS, PROFESSORSHIPS AND FACULTY ACADEMIC PROGRAM FUNDS CREATED SINCE THE BEGINNING OF THE CAMPAIGN 200M200M 150M 100M100M 50M 6 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y SLUMA Offers Online Exhibits Looking for a cultural fix from the comfort of your home? Visit the Saint Louis University Museum of Art virtually and tour immersive exhibits ranging from the role rising temperatures play in affecting insect song to the Civil War. The University’s museums and galleries remain closed to the public until further notice. Learn more and plan a virtual visit at slu.edu/sluma. ARTS SLU Partners with Neighborhood Association for Housing Saint Louis University and the Gate Di s t r ic t Wes t Neighborhood Association held a groundbreaking ceremony in September to celebrate nearly 50 new homes and condos coming to the Midtown neighborhood near the University’s medical center. While SLU owned the par-cels and was closely involved in the redevelopment process, the neighborhood association took the lead in issuing requests for proposals and selecting developers. “You can do a development to a neighborhood or you can do a development with a neighborhood. This devel-opment was done with the neighborhood,” said Lewis Reed, president of the St. Louis Board of Aldermen. Marlene Davis, alderwoman of the 19th Ward, gave kudos to Brooks Goedeker (MSW ’04), director of the St. Louis Midtown Redevelopment Corp. This joint effort between SLU and SSM Health oversees development in a 400-acre area that includes Gate District West. The neighborhood association selected four develop-ment firms to acquire the SLU properties: Simone’s LLC, Black Lab Development, Prime Property Investments and UIC Homes. Their plans call for a total of 35 sin-gle- family homes and 12 condos with prices ranging from the 200,000sto200,000s to 300,000s. The association also selected a proposal from Habitat for Humanity Saint Louis, which plans to build seven new affordable homes in the neighborhood. SLU sold the parcels at a below-market price and used the proceeds for a home-repair program for current neigh-borhood residents. The new housing is expected to be finished in the next two years. A bulldozer breaks ground on one of the parcels in the Gate District West neighborhood that are being redeveloped for new housing. New SSM Health Saint Louis University Hospital Opens Saint Louis University and SLUCare Physician Group joined SSM Health in a celebration of the new SSM Health Saint Louis University Hospital and outpatient care facility. The new hospital opened Sept. 1. University President Dr. Fred P. Pestello ref lected on the decision to partner with SSM Health, a decision made early in his tenure at SLU. “It became clear to us that SSM Health was the partner for us, sharing our Catholic values and mission,” he said. “These two organizations always put patients first. So our patients will continue to get cutting-edge medical care by compassionate clinicians in a state-of-the-art facility.” The 550millionSSMHealthSaintLouisUniversityHospitalfeaturesmorethan800,000squarefeetofspace,316privatepatientrooms,anexpandedLevelItraumacenterandemergencydepartment,largerintensivecareunits,expandedparking,greenspaceandareasforfutureexpansion.ThenewcampuselevatesthepatientexperienceandenhancestheclinicalofferingsofSLUCare,theUniversitysacademicmedicalpractice.ThestateoftheartCenterforSpecializedMedicineisanoutpatienthubforSLUCaresprimarycareprovidersandspecialists.ItislocatedonGrandBoulevard,nexttothenewhospital.ThenewSSMHealthSaintLouisUniversityHospitalandCenterforSpecializedMedicinePHOTOBYGARRETTCANDUCCISUBMITTEDPHOTOWINTER20217ONCAMPUSATHLETICSA10HonorRollIncludedRecordNumberofBillikensLastsummer,arecordnumberofSaintLouisUniversitystudentathletes259Billikensearnedinclusiononthe201920Atlantic10ConferenceCommissionersHonorRoll.Tobelistedonthehonorroll,astudentathleteinanA10sponsoredsportmusthaveatleasta3.0cumulativegradepointaveragefortheentireacademicyear.SLUHonoredforExcellenceinGreenPowerSaintLouisUniversitywasnamedbytheU.S.EnvironmentalProtectionAgency(EPA)asoneoftheagencys12topGreenPowerPartners.Greenpoweriselectricitygeneratedfromenvironmentallypreferablerenewableresources,suchaswind,solarandgeothermal.Two550 million SSM Health Saint Louis University Hospital features more than 800,000 square feet of space, 316 private patient rooms, an expanded Level I trauma center and emergency department, larger intensive care units, expanded parking, green space and areas for future expansion. The new campus elevates the patient experience and enhances the clinical offerings of SLUCare, the University’s academic medical practice. The state-of-the-art Center for Specialized Medicine is an outpatient hub for SLUCare’s primary care pro-viders and specialists. It is located on Grand Boulevard, next to the new hospital. The new SSM Health Saint Louis University Hospital and Center for Specialized Medicine PHOTO BY GARRETT CANDUCCI SUBMITTED PHOTO WINTER 2021 | 7 ON CAMPUS ATHLETICS A-10 Honor Roll Included Record Number of Billikens Last summer, a record number of Saint Louis University student-athletes — 259 Billikens — earned inclusion on the 2019-20 Atlantic 10 Conference Commissioner’s Honor Roll. To be listed on the honor roll, a student-athlete in an A-10- sponsored sport must have at least a 3.0 cumulative grade point average for the entire academic year. SLU Honored for Excellence in Green Power Saint Louis University was named by the U.S. Environmental Protection Agency (EPA) as one of the agency’s 12 top Green Power Partners. Green power is electricity generated from environmentally preferable renewable resources, such as wind, solar and geothermal. Two 1 Million Gifts Support Campaign THE BIONDI CHAN SCHOLARSHIP SLU trustee Dr. Winston Chan (A&S ’81, ’83) made a 1 million gift to the University to create the Biondi Chan Scholars Fund, which supports students from rural areas of China who require financial assistance to study at SLU. The new scholarship is named in honor of SLU President Emeritus Lawrence Biondi, S.J., whom Chan has worked with extensively on stu-dent recruitment and alumni engagement in Asia, and Chan’s father, Frank L. Chan, whom he credits with giving him the opportunities that led to his success. “Father Biondi’s global mindset has done good things for the University,” Chan said. “I think every-body should have a chance, and with this funding, we’ll be able to get really top-notch but underprivi-leged students to SLU.” Raised in Hong Kong, Chan is the chief executive officer of Corvusys Inc., a financial services company headquartered in Virginia. A long-standing SLU sup-porter, Chan received the College of Arts and Sciences Alumni Merit Award in 1998 and became a University trustee in 2007. THE WHEELER ENDOWED ONTOSSCIENCE RESEARCH FUND Former SLU fac-ulty member Dr. Rober t Wheeler Sr. (Grad A&S ’78) gave 1 million in support of the psychology department. The gift creates the Wheeler Endowed OntosScience Research Fund. Inspired by the Greek word “ontos,” which translates to “meaning of existence,” the fund will advance research about basic human motivation and will include graduate psychology research, assis-tantships, seminars, courses and more. “The psychology department at SLU has great poten-tial for pursuing this line of research and really helping humanity,” Wheeler said. “I have become convinced that the secret to further advancement of humanity is for people to get back to their basic motivation, the basic thing that we are driven by. And that’s to under-stand what’s going on, to try to contribute and advance the cause of civilization, society, humanity.” Wheeler earned his doctorate in psychology at SLU after 20 years in the military. He had a 20-year career at the University and held various positions, including the director of health promotion research and adjunct associate professor of psychology. Chan Wheeler Teaching Award Honors Nursing Professor Dr. Geralyn Meyer (VSN ’79, Grad VSN ’83), a professor in the Trudy Busch Valentine School of Nursing, was selected as the win-ner of the 2020 Nancy McNeir Ring Award for Excellence

    University News - Volume 100[a], Issue 004 (December 9, 2021)

    No full text
    24 pages.VOL. C No. 4 / December 9th, 2021 photo by Abby Campbelll cover design by grace dunlavy FEATURED ON PAGES 12 & 13 christmas on the quad 02 NEWS s children, Amy and Phil Le spent most days after school at their mother’s Chinese restaurant. Greeting customers, helping out with the dishes and doing their homework in between, the siblings grew up im-mersed in this warm, local mom and pop food environment. Years after pur-suing their own paths, the siblings will soon open a restaurant together in the very place where their love for food first began. Saucy Porka, the new restaurant coming to Midtown (3900 Laclede Ave) in the old Kaldi’s storefront in Janu-ary 2022, is often misconceived as a pork-centered restaurant. The restau-rant’s name, though, is a reflection of the cuisine and the chef’s unique per-sonalities. Saucy refers to the marinat-ed meats and specialty sauces, while porka is the Puerto Rican slang term for a fiery or sassy woman. Combined, these words encompass the restau-rant’s essence: saucy food, created with love and so much attitude. Prior to developing the restaurant, Amy Le worked for the new start-up, GrubHub, as a social media content creator. As part of her job, she was constantly interacting with restaurant owners. On the side, she was also cook-ing for her friends’ birthdays and other events. That’s when she knew it was time for a change. “I just realized I missed this whole thing,” Amy said. “I missed the cama-raderie, I missed the cooking, I missed the speed, the stress. I just missed it all.” Amy decided to join the food truck movement in Chicago and opened her own contemporary Vietnamese banh mi truck, her entry point back into the food industry world. But her culinary career would soon take a dramatic turn when she met former executive chef Rafael Lopez. At the time, he was also operating a food truck near Amy, and after cooking together for events, they decided to develop something new: an Asian/Latin fusion menu. Amy and her husband, along with Lopez, opened the first Saucy Porka lo-cation in downtown Chicago in 2013, with a second location in Hyde Park in 2018. Now, after 20 years, the Le sib-lings will reunite in St. Louis for a third location. “It was always my dream and my passion,” Amy said. “Especially for my mom, because she wanted to see us come back together and work again. And I think everything was in the right moment at the right time for this to happen.” The Chicago location served many University of Chicago students, so Amy says she feels prepared to serve the various needs of SLU students, as well. “No matter how much we grow, at the heart of it we’re a family restaurant, and I want to continue that,” Amy said. “I want to not only expand this grow-ing ethnic cuisine in various communi-ties, but also to be…[a restaurant] that has a local feel that understands the neighborhood and the people.” While Saucy Porka is a fast service restaurant, Amy deeply values the con-nection that food can create between people. She still cherishes how her mother interacted with her customers and tries to incorporate that care in her own restaurant model as well. “When we talk about fusion, people think you can throw kimchi on a taco, and suddenly, it’s fusion,” Amy said. “But we wanted to try to [create] some-thing that incorporated the ingredients of both cultures in a way that’s authen-tic. I hope people enjoy it. It is unique and different, and I think St. Louis is definitely ready for it.” A saucy porka opens in old kaldi’s location january 2022 By ULAA KUZIEZ Staff Writer (Photo Courtesy of Amy Le) News 03 By ABHINAV VAYYETI Staff Writer On Wednesday, Nov. 24, the Nation-al Football League reached a 790millionsettlementwithSt.Louisofficials,endingafourandahalfyearlawsuitfiledaftertheRamsrelocatedfromSt.LouistoLosAngeles.ThissumofmoneywillbepaidoutbyNFLowners,withLosAngelesRamsownerStanKroenkeexpectedtobeakeycontributor.TheRamsleftSt.Louisin2016,playingtheirfinalgameinthecityonDec.17,2015.TheSt.Louiscity,countyandRegionalConventionandSportsComplexAuthoritythensuedtheNFLandtheRamsin2017.Thesettlementcompensatesfordamagesthattherelocationcaused,includingtaxrevenuethatwouldhavebeengeneratedfromticketsales,propertyandhotelswhichareallegedtobeover790 mil-lion settlement with St. Louis officials, ending a four and a half year lawsuit filed after the Rams relocated from St. Louis to Los Angeles. This sum of money will be paid out by NFL owners, with Los Ange-les Rams owner Stan Kroenke ex-pected to be a key contributor. The Rams left St. Louis in 2016, playing their final game in the city on Dec. 17, 2015. The St. Louis city, county and Regional Convention and Sports Complex Authority then sued the NFL and the Rams in 2017. The set-tlement compensates for damages that the relocation caused, includ-ing tax revenue that would have been generated from ticket sales, property and hotels which are al-leged to be over 100 million. In addition, the settlement of 790millionencompasses790 million encompasses 550 million which Los Angeles Rams owner Stan Kreonke paid to other NFL owners in order to carry out the relocation process, which the county, city and RSC allege was something wrongfully paid and something they should have re-ceived. After taking into account 276.5millionforlegalfees,thethreesuingpartieswillbepaid276.5 million for legal fees, the three suing parties will be paid 514.5 million by Christmastime. One of the three plaintiffs is the Regional Convention and Sports Complex Authority (RSA) which currently owns The Dome at America’s Cen-ter, the St. Louis stadium the Rams used to play in. It has not been decided how the money will be divided between these three plaintiffs, however, at-torneys are currently working on it. Rita Days, a St. Louis County chair-woman, suggests that the money should be put toward developing a North County recreation center. In addition, she feels that all three plaintiffs should work together to put their money toward one larger project. One possibility that St. Louis Post Dispatch columnist Tony Messen-ger suggested is Michigan’s Kalamazoo Promise. If St. Louis modeled its own ver-sion, the project would promise to pay for the in-state university tuition of graduates of a school district in the area. Money gained through other sources such as the Infrastructure Bill, Build Back Better Bill and the Ameri-can Rescue Plan is already being put toward prominent issues in St. Louis, such as rebuilding downtown, invest-ing in both northside and southside housing and rebuilding the Conven-tion Center. As a result, Messenger feels that the money would be best spent on a larger project that affects the lives of many St. Louis residents for generations to come, along the lines of promising every St. Louisan downpayment on a house or money to go to college. Because the lawsuit sought more than 1billion,someSt.Louisresidentsareleftunsatisfied,astheyfeeltheycouldhavegottenmoremoneyfromtheNFL.Othersarecontentthatthecityreceivedanymoneyatall.WhatisclearisthatSt.Louisnowhasaccesstoalargesumofmoneythatcanbeputtowardimprovingcommunitiesandneighborhoods,anddiscussionsmustbehadregardinghowtobestutilizethesefunds.ByGABBYCHIODONewsEditorST.LOUISCITYWINSNFLRAMSLAWSUITOSIGNSPOINTTOAMIDTOWNTOPGOLFLOCATIONOnDec.1,2021,theSt.LouisPlanningCommissionvotedinfavorofrezoninglandintheheartofMidtownforapotentialTopgolfsportsentertainmentfacility.Inplansfiledwiththecity,SaintLouisUniversitystatedthelandwouldhostanoutdoorrecreationandgolfentertainmentcenter.Whilenospecificopertorislistedintheplans,Topgolfhasbeeneyeingtheareaforawhile.Foundedin2000,Topgolfsportsentertainmentcompanyfeaturesagametheyclaimanyonecanplay.Massivecomplexes,averagingnearlytwoacres,hostthousandsofpeopleastheyhitamicrochippedballintoagiantfieldwithdifferenttargets.Thegameitselfisnotfocusedonskill,butratherthetimelessquestionofgolf:Whohititcloser?WiththefirstlocationopeningintheUnitedKingdom,thesimplicityofthegameiswhatfirstattractedattendees.Soon,thefoundersrealizedtheyhadtheopportunitytobecomeanentertainmentcenterformorethanjustpeopleinterestedingolf.In2012,TopgolfbuiltamassivecomplexinKaty,Texasthatfeaturednotonlygolfing,butfoodandbeverageoptions,aswell.TheMidtownTopgolfwouldbetheregionssecondlocation.AnearbyTopgolfinChesterfieldMissouri,whichopenedin2018,hasgarneredeconomicsuccessandhighpraisesfromMissouriresidents.Reviewsleftonthelocationswebsitenotethatthefunatmosphereandfoodisfamilyfriendlyandworththeprice.However,thelandthattherumoredTopgolffacilitywouldbebuiltonisinthecenterofSaintLouissMidtownratherthanthecityssuburbs.SeveralformsweresubmittedtotheFederalAviationAdministrationtoensuretherewouldbenoobstructiontoairplanesorotherformsofairtravel.Theprojectsrezoningapprovalcomesafteralongwait.SLUhasbeenattemptingtoutilizethelandsincepriortothepandemic.However,withtheCityFoundryalreadyintheworksin2020,theUniversitysproposalwasputonhold.ThedesignplanfiledwiththecitystatesthatthefacilitywouldbebuiltnearChouteauAveandSouthComptonAvenue.ThislandisownedbySaintLouisUniversityandiscurrentlyhometoparkinglotsandapracticefieldfortheUniversitysstudentathletes.LocatedneartheUniversitysmedicalcampus,theconstructionofthecomplexcouldstartrelativelysoon.Otherrealestateplansareintheworksforthisarea,includinganewapartmentbuildingandaTarget.SLUannouncedtheplanforthe1 billion, some St. Louis resi-dents are left unsatisfied, as they feel they could have gotten more money from the NFL. Others are content that the city received any money at all. What is clear is that St. Louis now has access to a large sum of money that can be put toward improving communities and neighborhoods, and discussions must be had regarding how to best uti-lize these funds. By GABBY CHIODO News Editor ST. LOUIS CITY WINS NFL RAMS LAWSUIT O SIGNS POINT TO A MIDTOWN TOP GOLF LOCATION On Dec. 1, 2021, the St. Lou-is Planning Commission voted in favor of rezoning land in the heart of Mid-town for a potential Top-golf sports entertainment facility. In plans filed with the city, Saint Louis University stated the land would host an “outdoor recre-ation and golf entertainment center.” While no specific opertor is listed in the plans, Topgolf has been eyeing the area for a while. Founded in 2000, Topgolf sports entertainment compa-ny features a game they claim anyone can play. Massive complexes, averag-ing nearly two acres, host thousands of people as they hit a microchipped ball into a giant field with different targets. The game itself is not focused on skill, but rather the timeless question of golf: “Who hit it closer?” With the first location opening in the United Kingdom, the simplicity of the game is what first attracted attendees. Soon, the founders realized they had the opportunity to become an en-tertainment center for more than just people interested in golf. In 2012, Top-golf built a massive complex in Katy, Texas that featured not only golfing, but food and beverage options, as well. The Midtown Topgolf would be the region’s second location. A nearby Topgolf in Chesterfield Missouri, which opened in 2018, has garnered econom-ic success and high praises from Mis-souri residents. Reviews left on the location’s website note that the fun atmosphere and food is family friendly and worth the price. However, the land that the rumored Topgolf facility would be built on is in the center of Saint Louis’s Midtown rather than the city’s suburbs. Sever-al forms were submitted to the Feder-al Aviation Administration to ensure there would be no obstruction to air-planes or other forms of air travel. The project’s rezoning approval comes after a long wait. SLU has been attempting to utilize the land since prior to the pandemic. However, with the City Foundry already in the works in 2020, the University’s proposal was put on hold. The design plan filed with the city states that the facility would be built near Chouteau Ave and South Comp-ton Avenue. This land is owned by Saint Louis University and is currently home to parking lots and a practice field for the University’s student-athletes. Lo-cated near the University’s medical campus, the construction of the com-plex could start relatively soon. Other real estate plans are in the works for this area, including a new apartment building and a Target. SLU announced the plan for the 60 million Target development in late October of this year. With SLU being eligible for tax abate-ments and incentives, some wonder if they will be granted for this project. These elements would lower the cost of the building and potentially allow the construction to proceed faster than normal. Marelene Davis, Alderwoman for Ward 19, the district in which this land resides, states that no incentives have been asked for by SLU, nor are they ex-pected. An official announcement has yet to be made by either SLU or Topgolf. Photo Courtesy of Topgolf (Grace Dunlavy/ The University News) T 04 NEWS Photo he student-run anon-ymous sexual assault hotline SAM, now in its second semester, has seen rapid growth in both volunteers and callers as pandemic restrictions ease. Now, SAM is looking to ramp up its efforts at SLU and add chapters to other colleges across the country. “It makes me happy to see that peo-ple are interested in SAM,” vice-chair-man Mia Filipe said. “I think a lot of people are passionate about the cause.” The group, now a nonprofit, has net-worked with other established organiza-tions, such as a similar group at Wash-ington University in St. Louis (WashU). SAM also met with the team behind the mobile app Unmasked, which is aimed at providing college students with mental health resources. Filipe said SAM, which was founded by SLU students, plans to expand to other universities in the next couple of years. “We wanted to focus on first making sure we were really established at SLU and that people knew about us and that everything was going smoothly until we started branching out, but that is some-thing we’re in the process of right now,” Filipe said. SAM, which was officially founded NOW INDEPENDENT, STUDENT RUN SEXUAL ASSAULT HOTLINE LOOKS TO EXPAND By ALEX ROZAR Staff Writer in 2015, began running the hotline in the spring 2021 semester. The group, at first, was not a chartered student or-ganization (CSO), but affiliated them-selves with the university last year af-ter a run-in with administrators over whether they could post flyers on cam-pus, Filipe said. Initially, SLU said only CSOs could advertise on campus, and SAM went through the process of being such a group to comply with this rule. Following further conflicts with SLU administrators, SAM retained the counsel of an attorney and SLU Law professor John Ammann, who offered to work for the group pro bono. Am-mann helped the group register as a 501(c)(3) nonprofit with the Internal Revenue Service (IRS). “Just by SLU itself, we were defi-nitely a lot more well-respected once he was on board,” Filipe said. SAM then signed a memorandum of understanding (MOU) with SLU, al-lowing them to advertise the hotline on campus, Filipe said. Their funding comes from state and federal grants and tax-deductible donations and prof-it- sharing events from corporations. “It’s definitely been really reward-ing, seeing how SAM has grown and seeing how we’ve grown to be respect-ed,” Filipe said. Being a nonprofit group and having a lawyer on standby has allowed the hotline greater freedom, Filipe said. “It’s a lot of sensitive work, and there’s a lot of legal things surround-ing that because for liability purposes, people don’t want to get in trouble,” Filipe said. “That’s why we have our own insurance, we have our own ev-erything.” Still, they have run into some sna-fus. Filipe recalled a recent incident where an officer of the Department of Public Safety (DPS) demanded SAM give them information the group had collected, seemingly unaware of the hotline’s independent status. “It was just nice to be able to say, ‘Talk to our lawyer about this, because you clearly do not know what you are talking about,’” Filipe said. According to mandatory disclo-sures made by the university under the Clery Act, there have been 18 inci-dents reported to SLU’s Title IX office this semester, including seven report-ed rapes. SAM has received far more calls than that, Filipe said, adding that SAM operators are trained to present all available options to callers without preference toward any option in par-ticular. “We’re first here to listen to what that person is looking for,” Filipe said. “It’s really going to be dependent on what the survivor is looking for, and we kind of just go step-by-step through there.” Given the nature of their work and concerns over the possibility of outside pressure from university or government officials, SAM does not collect personal information from callers, Filipe said. All callers remain anonymous, and when a person dials the hotline, their phone number is obscured from the other end. The call is then taken up by one of the multiple volunteers via the program Google Voice. Operators also remain anonymous by group policy, identifying themselves to callers as only “Sam”. The only information taken down by hotline operators relates to the case specifically, information such as whether the caller was planning to seek counseling, Filipe said. Operators are required to take 40 hours of training, completed through the video-conferencing application Zoom. In those sessions, operators are trained on identity-related factors, Filipe said, teaching them how specific issues may relate to people of color, members of the LGBT community, or male victims, for example. “A really core principle and value to SAM is empathy,” Filipe said. “That’s really trying to take yourself out of your shoes and put yourself in some-one else’s, no matter what that person is going through. And a big part of that is recognizing, ‘I may not understand what you’re going through, but I hear you and I’m going to try to help you to the best of my ability.’” The hotline is active on Thursdays, Fridays, and Saturdays beginning at 10 p.m. and going to 4 a.m. the next day, and is active from noon to 4 p.m. on Sat-urdays and Sundays. News 05 unior SLU student and Labre co-presi-dent Hannah Nodge remembers meeting Brian her freshman year. She was volun-teering with St. Ben-edict Joseph Labre Ministry with the Homeless (Labre), an organization with a focus on developing friendships and extending compassion to the im-poverished. While on an outreach trip, Nodge met Brian, a unhoused man who was living in downtown St. Louis. Nodge was carrying her Labre quote book, full of snippets of conversation that she wanted to remember from her time volunteering. Founded at SLU in 2010, Labre at-tempts to use food as a bridge to foster conversation and relationships with people experiencing homelessness. “We had this conversation where we were talking a lot about handwriting,” Nodge said. “We were talking about next week, how we’re gonna come back and we’re gonna have a cursive writing competition. And [Brian] said, ‘This right here, what you’re doing is ground zero...What you guys are do-ing is important.’” Nodge returned the next week as promised, but Brian was nowhere to be found. It would be over a year until Hannah saw him again. “I didn’t see him again until one day randomly last year at a different spot,” Nodge said. “And he was the one who recognized me and he remembered my name. I saw him continually the next few weeks after that, but that re-lationship I’ve shared with him is re-ally special.” The issues of homelessness and food insecurity are of critical impor-tance in the St. Louis region. A core part of SLU’s Jesuit identity involves compassionate service for others and the practice of good works. With these ideals in mind, a number of By BRIAN GUERIN Staff Writer Student organizations fight homelessness and food insecurity student service organizations at SLU have made a significant difference in the fight against food insecurity and homelessness. Dr. Tim Huffman studies home-lessness, nonprofit organizing and community collaboration, including the architectural, social and financial structures that contribute to urban poverty and homelessness. An asso-ciate professor in the Department of Communication, Huffman said that some of the national issues contribut-ing to homelessness are often reflect-ed at the local level in St. Louis. “St. Louis has a relatively inexpen-sive housing market, and part of that is because we have a shrinking popu-lation,” Huffman said. “Our homeless-ness isn’t shaped like New York or Los Angeles where nobody can afford to live even if they have a full time job. In St. Louis, the problem is that peo-ple are unlikely to find housing that’s affordable, but also safe and quality. It’s not just a housing affordability problem, it’s the intersection between safety, affordability and quality.” Several student organizations have taken initiative and developed out-reach efforts to help those who are unhouse and food insecure. Founded in 2001, student volunteers in Cam-pus Kitchen use kitchen space and do-nated food from their cafeterias, local grocery stores, food banks and restau-rants to prepare and deliver meals to those in need. SLU senior Denise Gomez started volunteering at Campus Kitchen her freshman year. Serving as a shift lead-er and executive board member, Go-mez eventually became president of Campus Kitchen this past year. “I always like to start off by telling people that 40 percent of food in the U.S. goes to waste every single year,” Gomez said. “And 40 million peo-ple in the U.S. are also food insecure across the country. We take that extra food and we repurpose it into about 400 meals every week and have that served out to our community partners throughout the local area.” Gomez said she was drawn to the idea of connecting and forming rela-tionships with individuals in need on delivery shifts, and that it was import-ant for SLU students to reach out and witness firsthand the positive impact they can have. “I think it’s really important to un-derstand the issues that face the peo-ple that permanently live here, not just people that spend four years here and then move on and graduate,” Go-mez said. “ It’s a really gratifying ex-perience, trying out every step of the volunteer process, from picking up the food, to cooking it, to packaging it to handing it to the people directly.” A similar organization, Billiken Boun-ty, is partnered with Campus Kitchen. Billiken Bounty is an on-campus food pantry that serves SLU students. The food pantry also looks to destigmatize food insecurity and educate SLU stu-dents on the issue. “We have a client exit survey, and reading people’s responses really em-phasizes how important a resource [the food pantry] can be,” said Maxine Taylor, the junior co-chair of Billiken Bounty. “People have explained how, due to Billiken Bounty, they are able to de-vote more time to school, or devote finances to other resources that they need, whether that’s paying tuition or paying rent,” Taylor said. “It’s re-ally nice to know that by having this service, we’re able to alleviate a lot of stress for those clients.” Taylor said that the food pantry is a valuable way to give back to the com-munity while improving the lives of fellow SLU students. “Food insecurity is a really pervasive problem that can really affect anyone at any point in their lives,” Taylor said. “A lot of peo-ple do have to face the issue of food insecurity at one point or another, whether it’s themselves or someone they know.” Junior SLU student and Labre co-president Mia Filipe said the deep-er mission of Labre initially drew her to start volunteering for the organiza-tion, and that it was inspiring to see the gratitude that volunteers are met with when delivering simple assis-tance in the form of blankets and hot food on outreach trips. “I just love how relationship-focused the work here is, because it doesn’t seem like it is just service,” Filipe said. “I love how the focus is developing friendships and how the whole point is to step out of your comfort zone, meet some new people and then con-tinually visit them to show that you care and to reaffirm their humanity.” Nodge said that her experiences in Labre shape the way she thinks about the role of the SLU community. “The second you walk off SLU’s cam-pus, if you go one block in any direc-tion, the immense poverty is clear,” Nodge said. “When you walk on this campus, you don’t recognize it any-more, because you’re at a billion-dol-lar institution,” Nodge said. “So I’ve just been thinking a lot about privi-lege and how we can change the nar-rative by focusing on the personhood of one another.” As part of Labre’s mission to help the homeless and food insecure, the orga-nization is currently holding a winter supply drive. Donations of blankets, socks, gloves, hats, scarves and other winter items are

    University News - Volume 100[a], Issue 001 (September 30, 2021)

    No full text
    24 pages.VOL. C No. 1 / September 3oth, 2021 UTHE UNIVERSITY NEWS Photo By Andrea Porter COver design by Grace Dunlavy Saint Louis University: A community in Mourning n Sept. 23, a crowd gath-ered at the clocktower in the middle of SLU’s cam-pus. A passerby asked a student, “What’s going on?” The student re-sponded quickly: “mental health town hall.” The passerby nodded knowingly. The town hall was held as an emergency response from administra-tion after two SLU students, a fresh-man and an upperclassman, passed away within nine days of each other. Both deaths were cases of suicide. At the mental health town hall, many students shared their experi-ences struggling with different men-tal illnesses. Most felt they had not been supported by members of SLU’s faculty and staff. The most alarming reports were the ones that came from students who had poor experiences with the University Counseling Center on campus. There were reports of long wait times, insensitive comments and insufficient resources. Some of these testimonials came from the days following the two suicides, but many were from months or even years ago. Senior Alyssa Cook said she has not felt supported by her University in her mental health jour-ney for years. In an interview with The University News, Cook disclosed that beginning in the fall of her freshman year, she had been feeling depressed and anxious, so she decided to take advantage of the ten free counseling sessions at the University Counseling Center. “Basically what I was told was that the counseling center didn’t have the tools needed to help me,” Cook said. Suggesting she seek psychiatric help, Cook attempted to make an appoint-ment at the Student Health Center. She was informed that the waitlist for the University’s psychiatrist was extreme-ly long and she was not able to get an appointment until December. Following the first tragic death at Saint Louis University, students re-ceived an email from Sarah Cunning-ham, Ph.D., the Vice President of Stu-dent Development, informing the SLU student body of a death on campus. Many students, however, criticized the administration for a lack of transpar-ency and communication. Members of Active Minds, the mental health awareness group at Saint Louis Univer-sity, felt the community hurting and asking for answers. “I definitely feel like the way that we’ve had a delay in communication has been difficult,” Julia Lansfreick, president of Active Minds, said. On the administrative side, Cunningham re-sponded to the difficulty of offering the student body transparency and closure while respecting the wishes of the fam-ily. “It’s not uncommon for an institu-tion to work really close with a family and they are really going to drive how and when and what we share,” Cun-ningham said. Administrators, though, say that mental health has and will continue to be at the top of their priority list. SLU President, Fred Pestello, Ph.D., echoed this sentiment in a recent interview. “Mental health is a tremendous concern, and there’s been a concern that that has been increasingly an is-sue for our students and on our cam-puses,” Pestello said. Cunningham corroborated this state-ment and shared several different av-enues the University is pursuing. One new effort she recently announced was SLU’s partnership with Medical Fami-ly Therapy, housed in SLU’s School of Medicine, to add capacity to the Uni-versity Counseling Center. Cunning-ham also noted that she has been try-ing to assess the wellness of students on campus and allocating different mental wellness resources to the Uni-versity since she began her job in Feb- SLU: A COMMUNIT Y IN MOURNING O 02 NEWS By GABBY CHIODO Associate News Editor (Andrea Porter/The University News) ruary 2021. After the second student suicide on Sept. 20, a petition began circulat-ing among students, family members and the community at large. Signed by over eight thousand people, the petition called for fourteen free counseling ses-sions, more highly trained counselors and an extension of Counseling Center hours to allow additional accessibility for students. SLU’s student body also vocalized through social media and emails the need to have time away from class to mourn the loss of the two Billikens. The University’s Provost, Michael Lewis, Ph.D., canceled all undergraduate class-es on Friday, Sept. 24. “I spoke with students and listened and had my mind changed, to be frank,” Lewis said. “That’s why you listen. You don’t listen to stand your ground. You listen to evolve.” The decision to cancel class was ini-tially met with criticism from some in the SLU community. According to Lewis, parents complained that a lack of struc-ture would make students feel more iso-lated and anxious. To try and combat this, the SLU administration worked to schedule all-day wellness programming, providing a space for students to grieve with each other. Lewis stated “I’d say the intention and thought that went into continuing classes on Wednesday and Thursday was the idea of programming. And what could we do to not just have it be an empty day for students.” The Friday classes were cancelled, students had the opportunity to attend various events, including trauma-in-formed yoga and spending time with therapy dogs. “It was clear from what we saw on Friday that many, many students did not want an empty day and they appreciat-ed what happened [the programming],” Lewis said. Still, the SLU community is and will continue to grieve the devastating loss of two young students. Students and ad-ministrators alike emphasized resources for those struggling to cope, both with these tragedies and in general. “This is the time to raise your hand and ask questions if you see your friends acting in a different way, or maybe show-ing up in a different way,” Cunningham said. “This is the time to be intrusive and get in someone’s busy and ask how they’re doing.” News 03 By ULAA KUZIEZ Staff Writer fter nearly three years of planning, the University is piloting its new-ly developed Core Curriculum to ap-proximately 270 freshmen students this semester. Previously, there was no cohesive curriculum that connected the dif-ferent schools, leading to difficulty in transferring across programs and a lack of shared experience between students. The Core, which is a minimum 32 credit hour experience, aims to foster collaboration and reflection to transform student learning. As-sociate Professor of English Ellen Crowell, Ph.D was appointed the Director of the University Core in May 2018 and has been working alongside a committee of other fac-ulty, staff and students to develop the curriculum. “The most exciting thing about this job was the ability to ask teach-ers to put aside what they have been doing and think creatively,” Crowell said. “In those early stag-es [we were] dreaming big and we built a lot of enthusiasm.” This semester, two out of eight sections of the Core were launched: Ignite First Year Seminar, which uses a small-group approach to inquiry, and the first sequence of Cura Personalis, Self in Communi-ty, which focuses on self-discovery and questions of history or identi-ty. Director of the Applied Behavior Analysis Program, Natalie Parks, Ph.D, is teaching the Behavior Analysis of Social Justice course for the Ignite Seminar requirement of the Core. “My hope is that I will ignite some passion inside my students in whatever social justice topic that they’re interested in and give them a set of tools for how to start ap-proaching that,” Parks said. “I [also] saw this as a great opportunity to introduce students to behavior sci-ence before their junior or senior year.” Senior Antron Reid applied to be-come an Undergraduate Core Fellow last semester and began in his role in August. As a student representative for Cura Personalis 2: Self in Contempla-tion, he attends faculty meetings and helps approve, deny or edit course sub-missions for that section. “In light of recent events that oc-curred on campus, I think this new Core is a way of integrating the idea of building up the whole person,” Reid said. “It will help us relate to each oth-er a lot better and it’s going to rein-force [a] sense of community.” Unlike other universities, Crowell explains that SLU is unique in involv-ing students in the creation and review of core classes. This decision to create the University Undergraduate Core Committee (UUCC) came in large part out of the 2020 Scholar Strike, in which some students demanded they have a say in the development of courses. “It makes you think, ‘Why haven’t we done this sooner?’” Reid said. “This education will be a lot more beneficial to students [when] they feel like they have a say in what they get to learn.” Freshman Marquis Govan opted into the pilot program this semester to experience this new academic endeav-or. He is taking two pilot courses, The Power of Communication and Cura Personalis 1. “I haven’t had much homework in either of these classes so far because the emphasis is on developing the per-son and character,” Govan said. “The [Power of Communication] class I am taking has made me more well rounded in just a couple of weeks about how I can support and be more inclusive to people with disabilities.” Crowell is looking forward to the implementation of the full Core next year and the impact it will have on in-dividual students and on the campus as a whole. “When we were creating the Core, we doubled down on student wellness,” Crowell said. “Cura Personalis, or care for the whole person, is the hallmark of Jesuit education. We said let’s make sure the Core lives SLU’s mission by making our Cura Personalis sequence both required for all students and cred-it- bearing.” s of Fall 2021, most of SLU’s study abroad pro-grams have officially re-opened after travel was suspended for multiple semesters due to the COVID-19 pandemic. During the se-mester prior, in Spring 2021, around 45 students were able to study at SLU Madrid with restricted access to trav-el after a full year of suspended study abroad programs. Margaret Kessler is a study abroad counselor at SLU who works primarily with students interested in non-Ma-drid programs, as well as faculty and staff who are looking to lead short-term programs. She shared that out of the more than 40 abroad programs SLU offers, only two are still suspend-ed this semester: Australia and Viet-nam. “The Australian borders are closed, so students wouldn’t be allowed into Australia. There are also some pro-grams that we work with where the host institution is no longer support-ing students going,” Kessler said. One of these institutions is Loyola University Chicago, who has sus-pended their program in Vietnam for the Spring 2022 semester due to the pandemic. Though these programs remain temporarily suspended, many others are becoming increasingly re-laxed on COVID-19 restrictions. Mia McGrath is a junior who is currently studying on SLU Madrid’s campus, something she’s been hoping to do since beginning college. While she originally wanted to go during the Spring of 2021, she’s grateful she waited an extra semester for the city to open up more. “When I decided to go, I thought even if COVID is still bad, I’ll either be in lockdown in Missouri or Madrid, and I’ve already done it once in Mis-souri, so I might as well go,” McGrath said. “I set my expectations super low because I thought I might not be able to travel at all.” So far, though, McGrath has been able to travel every weekend she’s been there, which she credits to her being vaccinated. “It’s strange because other than the masks, it pretty much feels nor-mal,” McGrath said. “For most coun-tries you just have to show your vac-cination card.” According to Kessler, SLU has an international travel advisory com-mittee, which has been in place since before the coronavirus pandemic, to assess proposals made by students or faculty wanting to travel to coun-tries that the U.S. Department of State (DOS) or the Centers for Dis-ease Control and Prevention (CDC) has deemed a restricted region. The committee is composed of members across the University, including fac-ulty for the Dean of Students’ Office, members of the public health sector on the medical campus, the general counsel and risk management “Before COVID-19, it was most-ly about safety and security,” Kessler said. “So, if there was crime or an ep-idemic within that country.” Although travelling is still not guaranteed due to the ever-changing nature of COVID-19, Europe’s travel restrictions have relaxed significant-ly since the Spring 2021 semester, which McGrath hopes to take advan-tage of. Currently, she’s looking forward to weekend trips to Switzerland, Germa-ny, Austria, Paris and London. During the week, McGrath looks forward to hearing about other students’ travels during her Latin Rhythms class. “You dance with all the guys, and you rotate partners,” McGrath said. “So in Tuesday’s class, you’re like ‘How was your trip last weekend? Where did you go?’” McGrath said. “And in Thursday’s class, you’re like ‘So, where are you going this week-end?’” While McGrath loves the aspect of being able to travel relatively freely throughout Europe, she’s also grateful for the time to practice her Spanish and learn about the culture of Madrid. “It just totally changes your per-spective on everything, just being around people of different cultures every day,” McGrath said. “I think that’s like the coolest part so far is constantly being reminded that the world is bigger than you, and there’s so much to learn from everyone.” By ZOË BUTLER News Editor CORE CURRICULUM PILOT LAUNCHES A SLU STUDY ABROAD CAUTIOUSLY RESUMES A ith twenty dif-ferent places for students to eat across campus and six separate meal plans, DineSLU residential and retail locations are committed to serving thousands of students ev-ery day. Students with food aller-gies or dietary restrictions are wel-comed as part of that population. The feedback from students with dietary needs is a valuable way to assess and improve an essential part of the experience at SLU. Lia Basden, a sophomore com-munications student, shared her thoughts on DineSLU and eating with dietary restrictions. “My ju-nior year of high school I was di-agnosed with celiac disease, which is an autoimmune disease in which your body can’t digest gluten,” said Basden. Basden is also lactose intoler-ant and vegetarian and said that the reputation of the dietary ac-commodations at SLU was a major part of her college decision. Basden struggled to find dining options last year and explained that the Simple Servings station was often the only place she was able to eat, due to cross-contamination and allergens. “They didn’t even serve breakfast at Simple Servings. Last year I was all on my own for break-fast, and I was paying for an unlim-ited meal plan but I can only use two swipes a day.” Basden said she would have also liked to see more vegetarian op-tions, especially protein-rich veg-etables. Sophomore Drew Gibson, who has Crohn’s disease, echoed the sentiment. “DineSLU has a lot of options for students and makes sure students have enough options each day. However, they don’t always have the best options for those with di-etary restrictions or don’t give enough food, which makes it tough on certain students.” Gibson said that while he feels DineSLU service is always exceptional, delivering consistent options for these stu-dents should be a priority. Another area for potential im-provement was flexibility with meal plans and disability accommoda-tions for residential students, as Basden said it took multiple tries to get accommodation without an apartment. “I think the most frustrating part is the fact that these other colleges would have been worse. And I know, again, part of it was COVID because when I met with the dietician be-fore [the pandemic] she showed me the dining hall they had all kinds of prepackaged gluten-free meals. The most important part is that I never got sick from the food, so obvious-ly they do a good job training the workers and it was safe. However, I always felt like it could’ve been bet-ter.” DineSLU Director of Operations Myron Bridges has supervised col-legiate dining in nine separate uni-versities across five states and said that his experience of nearly two decades in the industry has given him perspective. “As time evolves, the allergies become more complex. So you can’t just say a person with a gluten-free 04 News By BRIAN GUERIN Contributer allergy or gluten-free need is in the same basket with everyone” Bridges said. DineSLU has been steadily increasing the variety and availability of its offerings, with the goal of communicating with stu-dents and prioritizing safety measures. DineSLU has a wide range of aller-gen- free foods and employs stringent food delivery, meal preparation, and utensil cleaning measures to avoid cross-contamination. “We build meals before they even touch population in a secluded area in the kitchen, so it’s not over where everybody’s cooking every-thing else,” Bridges said. “Everything is color-coded as a measure because we’ve got thousands of people going through daily.” Currently, DineSlu is working to increase vegan and vegetarian options by loading plant-based foods into retail lo-cations. Bridges said that the DineSLU team is actively working on establishing re-lationships and lines of communication with students who have dietary needs. An important part of the process for these students is meeting with the dietician Donna Foy and himself to create custom meal planning. Meeting with parents and students gives DineSLU the ability to make meals on request weekly for stu-dents with dietary needs or food allergies. DineSLU offers flexible weekly sched-ules for these students to pick up meals in between classes. Bridges often shops for the ingredients himself, buying gro-ceries or ordering foods to fit any food allergy or dietary restriction. “When I’m in the dining hall, I want to feel like I’m at home. We probably have about 14 stu-dents, who all have menus built and we build the meanings for them” Bridges said. “We have a couple of students that will text me and give me a list of things for dinner and then our culinary team puts it together for them to pick it up at the Simple Servings counter.” COVID-19 was an added challenge to serving students with dietary restrictions. DineSLU’s supply chain and staffing re-quirements were put to the test during the height of the pandemic. Bridges said multi-state shipments and acquiring de-livery drivers were difficult at times, but these were tests DineSLU was determined to overcome - particularly when it con-cerned students with dietary needs. “One of the last things I want is for dining ser-vices to be a negative experience as a part of the college experience,” Bridges said. “I want students to feel free to reach out by text, in person, or virtually. We’re hap-py to meet and make sure that we’re aid-ing and assisting our students.” W While students with food allergies struggle to find a variety of on-campus dining options, DineSLU works to build communication to accommodate student needs. (Abby Campbell/ The University News) Students with dietary restrictions Share their Experiences at SLU hen over a thou-sand Black Lives Matter protest-ers assembled on Saint Lou-is University’s campus in Octo-ber 2014, many of them expected to be met with tear gas and riot shields, like had happened just weeks before in near-by Ferguson, Mo. Jonathan Smith, Ph.D came armed with cups of coffee, and, seeing it was raining, umbrellas. Smith, the late Vice President for Diversity and Community En-gagement and Professor in African American Studies, passed on June 19, 2021 at the age of 61. He was a ti-tan for change both on and off-cam-pus, according to those who knew him, including SLU President Fred Pestello, Ph.D. “He was warm, gentle and kind,” Pestello said. “He was smart and effective. He loved the work. He moved us forward.” Smith kept a delicate balance in a difficult climate, maintaining mu-tual respect among activists and ad-ministrators alike. But he also held on to other lifelong passions. As the son of a minister, Smith’s faith was very important to him. He wrote poetry. He played the piano. As an adult, Smith ran marathons. He loved literature, frequently quot-ing from Dr. Martin Luther King Jr., James Baldwin and W.E.B. Du Bois. Smith’s father had been arrest-ed with Dr. King during protests in Selma, Alabama—a fact Smith took great pride in, Pestello said. “His orientation with music and with art intensified his sense of empathy, and I think that’s why he connected so well with people and could listen to people,” Gerald Ear-ly, Ph.D, the Merle Kling Professor of Modern Letters in African and African American Studies at Wash-ington University in St. Louis, said. Early taught Smith as he was study-ing for his Master of Fine Arts and later served as his doctoral advisor. Smith’s interests manifested in the world around him. He served as the Board President of the St. Louis Black Repertory Company and as his church’s music director. He helped establish a photo gallery depicting the Ferguson protests, which are currently displayed in the Busch Student Center. And Smith, a former literature student who had taken up poetry in college, kept writing as an adult, finding inspiration in reli-gion, family and music. “He was devoted,” Pestello said. “His faith was a part of his blood. He was a poet at heart, and he was a true humanist. All of these things informed his worldview.” Most of all, Smith was remem-bered by friends for his ability to bring people together, even in times of struggle. Now, following his death, the many communities he affected are coming together again. “I considered him a close personal friend, as many did,” Peste

    University News - Volume 099, Issue 009 (February 6, 2020)

    No full text
    Mislabeled as Volume XCVIV. 24 pages.VOL. XCVIV No. 9 / February 6, 2020 COVER Design by Rebecca LiVigni SLU Students Prepare for Upcoming Democratic Primaries UTHE UNIVERSITY NEWS O 02 NEWS Photo Courtesy of Riley Tovornik n Monday night, over 150 SLU students gathered at the CGC for the watch party of an Iowa Caucus that announced no offi-cial winner. The app used by the Iowa Democratic Party to relay numbers from precinct chairs malfunctioned, with none of the vote reported throughout the night. The app was coded by a tech firm run by former members of Hillary Clin-ton’s 2016 presidential campaign, known as Shadow Inc. SLU’s Political Science Department with help from the Political Round Table and the Center for Service and Communi-ty Engagement was in charge of organiz-ing the watch party. Steven Rogers, Ph.D., was the lead organizer for the event and has held that position since SLU’s first watch party in 2016. Along with the Iowa Caucus, SLU will be hosting watch parties at the CGC for the New Hampshire prima-ry on Feb. 11 and Super Tuesday on Mar. 3. “Our events provide the SLU commu-nity a central place to discuss politics and learn about the American electoral pro-cess,” said Rogers, in regard to the central aim of the SLU watch parties. Rogers also hoped that these events will spark more interest in politics for many students and inspire them to “become politically in- IOWA CAUCUS DEBACLE CASTS SHADOW OVER SLU WATCH PARTY By COLIN THIERRY Staff Writer volved on-campus.” The event ran smoothly with a live feed of CNN’s election feed on the big screen in the CGC along with tables and bleachers for students to sit and watch the night’s events unfold. There was a food table in the back with free pizza, snacks and drinks along with various ac-tivities for students to participate in at their tables as they watched the election results. The event kicked off with Rogers giving a presentation on theories about elections and public opinion before turning back to the CNN feed for the re-mainder of the night. SLU students with differing political opinions and backgrounds all gathered together on Monday night to watch the events of the Iowa Caucus unfold. SLU’s College Democrats and College Repub-licans each set up tables to talk to stu-dents and watch the election along with various other university-based political and advocacy organizations. There were supporters in attendance for all of the leading candidates in the field, including Bernie Sanders, Elizabeth Warren, Pete Buttigieg, Joe Biden and Amy Klobuchar. David Miller, a sophomore Klobuchar supporter, said that he looked for a can-didate who “wouldn’t restrict markets” and “allow for social welfare programs” without having socially conservative po-sitions. Klobuchar is the senior U.S. Sen-ator from Minnesota who is a part of the moderate wing of the Democratic field, along with former former Vice President Joe Biden and former South Bend, Indi-ana, mayor Pete Buttigieg. Sophomore voter Mccaully Bau-er said she would support a candidate who was “pro-immigration” and who would establish “social and healthcare reform.” While undecided, Bauer states that what our country currently has in place “should be radically different” and explained that she leans towards candi-dates Sanders and Warren. Sanders and Warren comprise the progressive wing of the Democratic field and propose more expansive social and economic policies. Sanders, senior Sen-ator from Vermont, most differs from Warren, senior Senator from Massachu-setts, based on his entirely grassroots campaign and his more comprehensive policy positions on Medicare for All, universal suffrage and free college/stu-dent debt cancellation. Senior Brett Jones, on the other hand, said he supports Sanders mainly for his policy positions. Jones asserted that Sanders is the “only candidate that supports Medicare for All unequivo-cally.” Jones also agreed with Sanders’ position on universal suffrage (voting rights for all), along with him being the only candidate who supports Palestine and does not take super PAC money. The general sentiment among SLU students in attendance was that they expected Bernie, Biden or Warren to win in Iowa that night. As the night wore on without any results coming in, the crowd of over 150 students progressively started to dwin-dle. Many students started to grow im-patient that nothing was happening and left the watch party within a few hours. By the time the clock hit 10, there were only around 20 students scattered around the CGC. The watch party ended without anyone knowing the winner of the Iowa Caucus. SLU students will have a chance to vote for their preferred Democratic can-didate during the Missouri primary on Mar. 10, a week after Super Tuesday. Since the Missouri primary falls on SLU’s spring break, any students registered in Missouri and will be out of town must vote early or with an absentee ballot. Visit headcount.org to register to vote and for more information on the Mis-souri primary. oting in the U.S. can be complex due to the variation in state laws regarding regis-tration. The process can be further com-plicated by voting via absentee ballot, even more so for submitting an absentee ballot from outside the U.S. The Federal Voting Assistance Program (FVAP) reported that the turnout amongst eligible voting Americans abroad was only seven percent, significantly lower than the domestic 72 percent turnout. More-over, only 30 percent of the gap was accounted for by logistical difficul-ties of voting while abroad. According to SLU’s Office of In-ternational Services, about 750-800 students participate in some kind of international program each year, with 159 students studying abroad during the fall 2019 semester. Al-though the Office of International Services sends some information to students studying abroad on how to vote, the process can still be diffi-cult. Senior Katie Ross, who studied abroad at SLU Madrid in fall 2018, stated, “It was slightly difficult to make sure I was doing the process all correctly and that I could complete it in time.” Registration The first step to voting in any election is registration. Voters can be registered for primaries and gener-al elections. Missouri holds “open” primaries, meaning anyone who is already a registered voter can partic-ipate, regardless of party affiliation or registration. However, some states require that voters be registered as Republicans or Democrats in order to vote in their respective primaries. If one is not registered to vote pri-or to studying abroad, they can do so in person at the local County Clerk’s office or the DMV. Applications for registration, which usually require little more than basic personal info such as a permanent address and so- V NEWS By MIKHAIL FAULCONER Staff Writer Illustration Courtesy of Ashlee Kothenbeutel cial security number, can also be re-quested by mail or printed and sent from home. Deadlines vary by state, and it is important to leave time both to confirm registration and to request an absentee ballot. Anyone can check their regis-tration status at Vote.org, as well as a number of other websites that work to educate on registration processes and generate greater awareness of and participation in elections. The Secretaries of State of Missouri, Illi-nois, Nebraska, Wisconsin, Ohio and Texas, also all feature websites that allow residents to check their voter registration and potentially change their registered address. Requesting an Absentee Ballot Abroad After registering to vote, one must request an absentee ballot to be sent to their abroad address or to an email box. It is very important to request the ballot early enough to ensure that the ballot can be re-turned either by email or mail before the deadline. SLU’s Madrid campus assists stu-dents with questions regarding reg-istration and absentee ballots. Ross commented, “The school did a great job making it known that we could vote and providing resources on how to register.” Additionally, large vot-er mobilization organizations like “Rock the Vote” have volunteers and staff in Spain that can offer some di-rect assistance to students. Finally, the U.S. Department of State and the FVAP answer FAQs, provide guides and other information on a state-by-state basis. Despite the number of resources available, many students, like their colleagues at home in the U.S., chose not to vote while abroad. Ross said, “It was definitely easier to choose not to vote.” Senior Emily Chisholm, who was also at SLU Madrid in the fall of 2018, commented, “Those who chose not to vote thought it seemed like a lot of work and effort. Being so far from home, they also did not feel informed on the candidates ... the [Rock the Vote] volunteers in the cafeteria also did as much as they could to guide us through the process, and to be hon-est, guilt us into voting.” Both Ross and Chisholm stated that in spite of the confusion and red tape that voting internationally can entail, voting was and is important and meaningful for students even while abroad. Chisholm stated, “I think for those of us who did vote, we felt like it was our civic duty. I still cared about the status of our country even though I was temporarily away from it.” Similarly, Ross said, “All votes matter and practicing this right is a great way to stay connected to your home country and state. It will help give you a sense of accomplishment and you will definitely not regret casting your vote.” HOW TO VOTE WHILE STUDYING ABROAD 03 Studying abroad? Want to vote? Here’s a guide to exercising your civic duty internationally. News By CONOR DORN Associate News Editor ince 2018, the University Un-d e r g r a d u a t e Core Committee (UUCC) has been working towards a universi-ty- wide common core that every student, regardless of major or college, will complete. On Friday, Jan. 31, the UUCC released the fi-nal iteration of the Core proposal to the SLU community. The final proposal is the cul-mination of more than two years of hard work from the UUCC. After settling on nine Student Learning Outcomes (SLOs) as the foundation for the common core curriculum, the committee began the core design process, a pro-cess that was multidimensional and collaborative. They drew in-put from the SLU community by sponsoring Core Invention Work-shops and inviting students, fac-ulty and staff to submit their own core designs. They also organized roundtables, bringing in core cur-riculum directors from Jesuit uni-versities across the United States and invited leaders in higher ed-ucation to give presentations on core trends at comparable under-graduate universities. Last August, the UUCC circu-lated a draft of the Core proposal to the SLU community, opening the floor for feedback and ques-tions. The reaction to the draft was mixed, and several major concerns were voiced at univer-sity- wide open fora, faculty as-semblies, and in the SGA senate chamber. Some students and faculty took issue with a perceived lack of emphasis on theology and philos-ophy, and the lack of an explicit foreign language requirement, which for many represent import-ant pillars of Jesuit education. Another common concern raised at open fora discussions was a question of implementa-tion and adequacy of resourc-es. Many departments, some of whom already struggle with funding issues, felt that the im-plementation of a new core would introduce further financial strain, strain that they did not have the resources to cope with. The proposal was also met with a significant amount of sup-port and encouragement. Faculty from across a wide range of col-leges applauded the UUCC’s de-votion to the arduous process of creating a university-wide core curriculum from scratch and praised the spirit of collaboration that had characterized the en-deavor. With the release of the final core proposal last Friday, Jan. 31, SLU’s colleges and schools now have until Mar. 20 to hold a yes/ no vote on the question of adopt-ing the proposed core curriculum. In the interim, the question on the minds of many is the degree to which the UUCC acknowledged and addressed the apprehensions raised. The most noticeable adjust-ment between the final proposal and the draft was a three hour reduction in the total number of credit hours constituting the core curriculum, from 35 to 32 credit hours. The difference was reached by reducing the first year “Ignite Seminar” from three down to two credit hours, making the second part of the... S n Dec. 13, 2019, Dr. Mona Hicks, the Associate Vice President and Dean of Students for the Division of Student Development at that time, ended her success-ful career at SLU. Dr. Kent Por-terfield, the Vice President at the time, also stepped down soon af-ter. Their leave left empty spaces in the division, and the university has since undertaken a search to fill those seats. While the search for an associate and permanent vice president will continue, Dr. Debra Rudder Lohe has taken on the role of serving as the Interim Vice President for the Division of Student Development. Lohe stepped into her new role with a considerable amount of experience. In her almost 25 years of serving higher educa-tion, more than 10 of those have been at SLU. While bringing along the skills and experience she’s attained from years in the field, she’ll also have the support and aid of the Interim Associate Vice President and Dean of Students, Donna Bess Myers. “Being able to serve as that support to Dr. Debie and moving things along—that’s what we’re here for.” stated My-ers, when speaking of her and other staff members support for Lohe. “The full set of things that are really focused on students, that are not academic, that are not faculty in classrooms, all of that is under the umbrella of student de-velopment,” said Lohe about the function of the division. While many were concerned about the changes that a new temporary leadership may bring to the division, Lohe described her and Myers’ role as only being to progress things that are cur-rently going on in the division. “I think the way that [Myers] and I think about the interim role is we’re keeping things going, keep-ing the ships in the water, [and] allowing things that were already in process to continue to move forward,” said Lohe. The Division for Student De-velopment is of the utmost impor-tance to many students and staff, and both Lohe and Myers plan on keeping it that way. With pressing issues like student mental health and preparation for next year’s incoming class, the Division for Student Development aims to en-sure that staff members feel sup-ported and have all the resources they need to help students here at SLU. For the Division of Student Development, student’s mental health is at the forefront. “[Stu-dent mental health and wellness], that continues to be on the minds of folks in student development, and I think to the extent we can continue to be good voices for what are the kinds of programs we need, what are the resources we need, and how do we empower you to be helpful to each other, so I think student wellness is a big, top of the list,” said Lohe. Although Lohe is only serving as the Vice President for Student Development temporarily, she is here to serve nonetheless with the aid of Myers. “Anything for students, that’s the cool thing about our gigs, anything for stu-dents,” said Myers, reflecting on her and Lohe’s positions. O By KLAUDIA WACHNIK Staff Writer (Riley Tovornik / The University News) MEET THE NEW INTERIM VP OF STUDENT DEVELOPMENT FINAL COMMON CORE PROPOSAL RELEASED 04 To read more of this article, please scan the qr code below: News 05 ne of SLU’s new-est centers for research, the Sinquefield Cen-ter for Applied Economic Re-search, began making its mark on the St. Louis community. The Sinquefield Cen-ter was established in 2019 thanks to a donation from Dr. Jeanne and Rex Sinquefield, and conducts research focused on “economic growth and social welfare than can inform public policy.” Michael Podgursky, P.h.D., the director of the Center said, “We are gathering longitudinal data on people. For example [the pipe-line of] kids to school to work.” Data collected by the Center will range from jobs held by certain people based on their education levels, their gender and other distinctive features down to com-muting trends of neighborhoods. Podgursky said that they were working to obtain data on a large number of topics, from many different unique sources, such as the Dese Department and the Department of Higher Education. The Center will use the data on a number of projects, including the current focus of workforce and educational development. Ana-lyzing and evaluating education and employment data could help to discover what ways the educa-tion system can be improved to help individuals and communi-ties grow and sustain economic development. “We are interested in human capital development,” said Pod-gursky. “We want to know where kids [in the education system] are succeeding and failing. We want to find out how we can make ed-ucation work better in the area.” Dr. Takako Nomi, who is an as-sociate professor of educational studies, also works with the Cen-ter researching education data, is focusing on the inequalities in “high school-to-college out-comes” from schools and districts across the St. Louis region. Another facet of the Sinque-field Center’s research is directed towards economic growth proj-ects throughout the area. One of the most exciting opportunities that the Center has for determin-ing if the economic growth is suc-cessful is the brand-new National Geospatial-Intelligence Agency (NGA) project being built in North St. Louis. Because the NGA proj-ect is an initiative that aims to bring employment and economic stimulation to the communities around it, the 1.7-billion-dollar endeavor allows the Sinquefield Center to have a unique “be-fore- and-after” picture of the projects impact. “Imagine throwing a rock into a still pond,” said Podgursky. “That’s what we are doing. Look-ing at ripple effects and impacts.” The Sinquefield Center is also creating opportunities for stu-dents and faculty at SLU. The Center is bringing together facul-ty and graduate researchers from across the University to work on a number of different projects. For example, Enbal Shacham, P.h.D., is using the big data collected by the Center to research the dif-ferent factors affecting health outcomes in the area. Beyond sponsoring faculty research, the Center hopes to hire more stu-dents, both undergraduate and graduate, and get them involved in the valuable work that they’re doing. O he saying ‘bad things come in threes’ has never been more true. Three of the sta-ple college bars around SLU have closed their doors since 2017, leaving univer-sity students without a tradition-al college bar in sight. The Library Annex, or “Lan-nex” as deemed by students, the vibrant late-night club and go-to for students and locals alike, joined two iconic establishments of the Midtown neighborhood, “Humphrey’s Restaurant & Tav-ern” and “Mi Caribe” when it closed its doors in the summer of 2019. According to The Library An-nex’s Facebook, the “last call” occurred June 8, leaving students without a familiar place to go when the fall semester started. Students of SLU knew these bars rarely saw an empty night on the weekends. If anything, they were gaining exposure from host-ing student events and serving as the center of the social experi-ence at SLU. Was this enough to keep their doors open? Megan Saksefski, a 2014 SLU alumna, discusses the previous student social life in Midtown. Al-though she was more than excit-ed to talk about her college dive bar, Saksefski was disappointed to hear it had closed since her grad-uation. “Nearly every major celebra-tion or night out began or end-ed at Humphrey’s. I would dare to say it was the social center of campus,” Saksefski said during our interview. She was worried about the cur-rent situation of students trav-eling off-campus for night-life. Saksefski mentioned, “Going any-where at night carries some risk, especially if drinking is involved. One of the reasons Humphrey’s was so great was because it was so close and within a safe walking distance. I worry for students that constantly have to travel long distances just to get together.” The Executive Director of St. Louis Midtown Redevelopment Corp., Brooks Goedeker, led the charge for “The Grove” neighbor-hood development, taking it from six businesses on the main strip to now 86 parcels of development. St. Louis developers would previ-ously tell him, “Midtown is good only about seven to eight months out of the year when students are there.” This is how Midtown turned into a waiting game. They are waiting for that density to emerge from locals moving to Midtown, so they can attract new bars and restaurants, but it is not that kind of neighborhood, yet... O Graphic Courtesy of Jack Connaghan SINQUEFIELD CENTER ENGAGES ST. LOUIS COMMUNITY By SAVANAN SEYER Staff Writer By KLAUDIA WACHNIK Staff Writer LAST CALL FOR SLU COLLEGE BARS Photo Courtesy of Steve Dolan To read more of this article, please scan the qr code below: 06 Arts and life y hand reaches for the black mouse pad on my laptop while my brain screams “No!” One short tap and my life will delve into drama, the drama that “The Bachelor” provides. My hand con-tinues its procession forward toward my laptop as my brain pro-tests. Finally, my fingers tap the mouse pad and “The Bachelor” recap begins to play. Despite my suspicion of the show’s premise, I continue to watch the Bachelor, just as so many others do, but why? The Bachelor is supposed to be the story of one man finding love. This man has 25 to 40 beautiful women competing for his hand in marriage. To stay on the show, each woman must receive a rose a

    Universitas: the magazine of Saint Louis University

    No full text
    Winter 2020 issue of Universitas: the magazine of Saint Louis University.10 facts about SLU-Madrid Page 14 RECORD-SETTING CLASS Page 20 NEW CAREER CENTER Page 24 ST. LOUIS JESUITS’ CONCERT Page 26 FACULTY EXPERT ON VICE PRESIDENCY Page 30 WINTER 2020 | 1 VOLUME 46, ISSUE 1 EDITOR Laura Geiser (A&S ’90, Grad ’92) ASSOCIATE EDITOR Amy Garland (A&S ’97) ART DIRECTOR Matt Krob CONTRIBUTORS Jessica Ciccone Marie Dilg (Grad SW ’94) ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER SLU-Madrid students in Plaza Mayor in the heart of Madrid Photo by Fernando Béjar Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 1 N. Grand Blvd., St. Louis, MO 63103. We accept email at [email protected]. Postmaster: Send address changes to Universitas, Saint Louis University, 1 N. Grand Blvd., St. Louis, MO 63103. Website: slu.edu/universitas Universitas is printed by Breese Printing and Publishing Worldwide circulation: 123,557 © 2020, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. New and returning students gather at the first 9 p.m. Mass of the school year in St. Francis Xavier College Church. PHOTO BY STEVE DOLAN F E ATU R E S D E PARTME NTS 14 ¿Sabías? Ten facts about SLU-Madrid that might surprise you. — By Laura Geiser 20 Top Class The freshman class is the largest in SLU’s history. — By Marie Dilg 24 Beyond Career Fairs SLU’s Career Services focuses on preparing students for life after SLU. — By Marie Dilg 26 Coming Home The St. Louis Jesuits music group says farewell with a sold-out concert. — By Amy Garland 30 Vice Presidential VIP Law professor Joel K. Goldstein is the nation’s top VP expert. — By Jessica Ciccone 2 On Campus Women’s soccer A-10 championship /// Record fundraising year /// Nursing school’s new name /// Midtown development update /// Rankings /// Opus Prize 34 Class Notes 35 Alumni Spotlight Angela Lewis (A&S ’04, Grad A&S ’07) 36 How I Got Here Jim Dean (CSB ’88) 40 Letters to the Editor 41 In Memoriam 44 By the Numbers 45 The Last Look That is certainly what our campus in Spain aims to achieve — and accom-plishes with great success. From signage to statutes, SLU-Madrid succeeds at carrying out our branding. But much more than that, it lives our mission. This campus shares our vision for building a better world with more Jesuit-educated graduates. To do so on the global stage is a testament to the power of a SLU education. The stories I hear from our students, both when I visit SLU-Madrid and those who come back to St. Louis after spending time studying abroad, never cease to amaze me. Their stories and experi-ences remind me why I was called to higher education. As you will see in this issue, our students absorb culture through their time with señoras, or host families, who help broaden their perspective of Spanish culture. (Read more on page 16.) Learning does not stop when our students leave class — and in this increas-ingly connected world, it is more important than ever to lead them to become informed global citizens. The excitement we feel at SLU crosses international waters, and I’m thrilled this issue brings you a flavor of the pride we feel for our Madrid and St. Louis campuses. From regional development to record-breaking enrollment and fundraising, we certainly look forward to sharing our good news. The start of our third century and SLU-Madrid’s 52nd year brought a record-setting year for us at Saint Louis University. Our freshman class in St. Louis broke all enrollment records with 1,900 students, surpassing our previous largest class by 200 students. (Turn to page 22 to learn more.) SLU-Madrid continues to draw hundreds of students from dozens of countries who learn and grow together. And thanks to our generous donors, we once again raised a record amount in gifts for scholarships, academics, research and other ini-tiatives. We are well on our way to our 500milliongoalinourcampaign,knownasAcceleratingExcellence:TheCampaignforSaintLouisUniversity.(Seethestoryonpage10.)Whilewecertainlycelebratetheseachievements,wewillneverrestonthem.Thatsthejoyandthechallengeofacademiaalwaysplanningandadaptingfortheeverchangingworldinwhichweoperate.Themanywaysinwhichwemeetthoseneedsisbroad.Forexample,regionaldevelopmentandthephysicalchangesacrosscampus.AswelooktoourUniversitysfuture,wecontinuetofocusonopportunitiesthatwillstrengthentheUniversityforgenerationstocome.YouwillreadmoreinthisissueaboutafewexamplesoftheburgeoningdevelopmentintheMidtownSt.Louisarea.Theseincludeprojectsonandoffcampus.MomentumandexcitementcontinuetobuildforournewInterdisciplinaryScienceandEngineeringBuilding,andwearethrilledthatprogresscontinuesonthenew,500 million goal in our campaign, known as Accelerating Excellence: The Campaign for Saint Louis University. (See the story on page 10.) While we certainly celebrate these achievements, we will never rest on them. That’s the joy and the challenge of academia — always plan-ning and adapting for the ever-changing world in which we operate. The many ways in which we meet those needs is broad. For exam-ple, regional development and the physical changes across campus. As we look to our University’s future, we continue to focus on opportunities that will strengthen the University for generations to come. You will read more in this issue about a few examples of the bur-geoning development in the Midtown St. Louis area. These include projects on and off campus. Momentum and excitement continue to build for our new Interdisciplinary Science and Engineering Building, and we are thrilled that progress continues on the new, 550 million SSM Health Saint Louis University Hospital and Ambulatory Care Center. All will open this fall. SLU is also proud to be involved in developments that lead the resurgence taking place in the city’s central core, such as the redevel-opment of homes in the Gate District West neighborhood near the hospital, and the forthcoming City Foundry. (Read more on page 13.) As we share in the story about Gate District West, we are grate-ful to our St. Louis community neighbors for sharing our vision for and commitment to growing stronger together. In closing, I ask that you remember how these stories and the many initiatives behind them help fulfill our noble mission. I also ask that you share our exciting news with those you know who are young — or young at heart — who are seeking higher edu-cation. Tell them about SLU and your experience. Our world always benefits from more truth-seekers and servant leaders who are Jesuit educated. May God bless you and Saint Louis University. Dr. Fred P. Pestello President I cannot tell you what it’s like to step off of a plane after an eight-hour flight to Europe, only to walk onto a campus that feels just like home. Or perhaps I don’t have to tell many of you — those of you who have studied at or visited SLU-Madrid, or our international students in St. Louis. PRESIDENT’S MESSAGE PHOTO BY FERNANDO BÉJAR Pestello talks with students outside of San Ignacio Hall at SLU-Madrid. 2 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 3 ON CAMPUS Women’s Soccer Wins A-10 Again The Billikens women’s soccer team defeated George Washington 3-1 in the Atlantic 10 Conference Championship title game in November, securing its second straight A-10 Championship crown. Senior Courtney Reimer was named the most outstanding player of the championship. Senior Emma Farley, sophomore Hannah Friedrich, senior Alli Klug and graduate student Mary Niehaus joined her on the All-Championship team. Over the season, SLU extended its school-record unbeaten streak to 16 games. Already the winningest class in SLU women’s soccer history, the Billiken seniors registered their 64th victory. The team lost to Notre Dame in the first round of the NCAA Championship. Reimer Celebrating with the A-10 trophy Reimer (center) hugs Annabelle Copeland (left) and Farley. Farley The team celebrates at Robert R. Hermann Stadium on campus. PHOTOS BY BILL BARRETT 4 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 5 ON CAMPUS University Offers New Academic Programs, Begins Comprehensive Review Process Saint Louis University began offering many new academic programs in the fall, including: UNDERGRADUATE Bachelor of Arts in Leadership and Organizational Behavior Bachelor of Science in Health Care Ethics Minor in Dance GRADUATE Master of Science in Biostatistics and Health Analytics Doctorate in Education Policy and Equity GRADUATE CERTIFICATES American Studies Cybersecurity Strategic Intelligence Women’s and Gender Studies The University also started a formal review of its academic programs. In spring 2019, the provost established the Academic Portfolio Review Committee, tasked with analyzing and making recommendations to the provost about the size and academic scope of the University’s portfolio of offerings. This process will eventually become a regular assessment tool for all graduate and undergraduate programs. Led by faculty, the committee has representatives from the student body and administration. Dr. Mark Knuepfer, a professor in the School of Medicine, serves as the committee chair. Signature Beam: Students, faculty and staff signed their names and good wishes on the beam that would complete the topping-out of SLU's new Interdisciplinary Science and Engineering Building. Saint Louis University leaders, St. Louis Mayor Lyda Krewson, trustees, students, faculty and staff members marked the topping-out of the University’s new 50millionISEBuildingonDec.6.Thebuildingwillopenintimeforclassesthisfall.PHOTOBYAMELIAFLOODSLUNamesNursingSchooltoHonorTrudyBuschValentineInAugust,SaintLouisUniversityannouncedthatUniversitytrusteeTrudyBuschValentine(VSN80)madeagiftof50 million ISE Building on Dec. 6. The building will open in time for classes this fall. PHOTO BY AMELIA FLOOD SLU Names Nursing School to Honor Trudy Busch Valentine In August, Saint Louis University announced that University trustee Trudy Busch Valentine (VSN ’80) made a gift of 4 million in support of the School of Nursing and Accelerating Excellence: The Campaign for Saint Louis University. In recognition of Valentine’s history of philan-thropic support of SLU totaling nearly 7million,theUniversityrenameditsnursingschooltheTrudyBuschValentineSchoolofNursingandhostedadedicationduringHomecomingandFamilyWeekend2019.ValentinesgiftwasmadeinhonorofformerdeansDr.TeriMurray(VSN79,GradVSN93,GradEd97)andthelateDr.JoanHrubetz(VSN60,GradEd70,75)fortheirlegacyofleadershipofthenursingschool.Thegiftwillsupportfacultydevelopmentaswellascontinuedacademicexcellenceamongtheschoolsfacultyinteaching,research,scholarshipandleadership.ValentinehasbeenamemberoftheSaintLouisUniversityWomensCouncilsince1990.ShejoinedtheSchoolofNursingExecutiveAdvisoryboardin2000,assumingthechairpersonrolefrom2006to2015.ShewaselectedtoSLUsboardoftrusteesin2017.ValentineandherfamilyhavebeensupportersofSLUsnursingschoolforyears.Hermother,GertrudeBuholzerBusch,establishedanundergraduatescholarshipandtheJoanHrubetzEndowedChair.In2012,ValentineandherdaughterChristinaValentineCammon(VSN12)establishedtheTrudyandChristinaBuschValentineEndowedLectureSeries.Nursinghasmademerespectpeoplefromallwalksoflife,andithasopenedmyheart,mindandlifetothewellbeingofothers,Valentinesaid.ImsoproudtobepartofaprofessionthatcaressodeeplyaboutpeopleandcanmakesuchapositiveimpactonthelivesofothersaprofessionthatlivesSLUsJesuitmissiontoseekahigherpurposeforthegreatergood.IamsogratefultotheSaintLouisUniversitySchoolofNursingandveryhappytohonorDeanTeriMurray,adearfriendandmentor,forhermanyyearsofserviceandmagnificentleadership.Anactiveconservationistandphilanthropist,ValentinealsohasworkedasavolunteernurseattheSalvationArmyResidenceforChildren,MercyHospitalandtheVisitingNurseAssociationHospiceprogram.ValentinePHOTOBYSTEVEDOLANNOTEWORTHYGRANTSGERIATRICCAREINMISSOURI7 million, the University renamed its nursing school the Trudy Busch Valentine School of Nursing and hosted a dedication during Homecoming and Family Weekend 2019. Valentine’s gift was made in honor of former deans Dr. Teri Murray (VSN ’79, Grad VSN ’93, Grad Ed ’97) and the late Dr. Joan Hrubetz (VSN ’60, Grad Ed ’70, ’75) for their legacy of leadership of the nursing school. The gift will support faculty development as well as continued academic excellence among the school’s faculty in teaching, research, scholarship and leadership. Valentine has been a member of the Saint Louis University Women’s Council since 1990. She joined the School of Nursing Executive Advisory board in 2000, assuming the chairperson role from 2006 to 2015. She was elected to SLU’s board of trustees in 2017. Valentine and her family have been supporters of SLU’s nursing school for years. Her mother, Gertrude Buholzer Busch, established an undergraduate schol-arship and the Joan Hrubetz Endowed Chair. In 2012, Valentine and her daughter Christina Valentine Cammon (VSN ’12) established the Trudy and Christina Busch Valentine Endowed Lecture Series. “Nursing has made me respect people from all walks of life, and it has opened my heart, mind and life to the well-being of others,” Valentine said. “I’m so proud to be part of a profession that cares so deeply about people and can make such a positive impact on the lives of others — a profession that lives SLU’s Jesuit mission to seek a higher purpose for the greater good. I am so grateful to the Saint Louis University School of Nursing and very happy to honor Dean Teri Murray, a dear friend and mentor, for her many years of service and magnificent leadership.” An active conservationist and philanthropist, Valentine also has worked as a volunteer nurse at the Salvation Army Residence for Children, Mercy Hospital and the Visiting Nurse Association Hospice program. Valentine PHOTO BY STEVE DOLAN NOTEWORTHY GRANTS GERIATRIC CARE IN MISSOURI 3.75 million Supported by a five-year grant from the U.S. Department of Health and Human Services, Dr. John Morley, professor of internal medicine, and Dr. Marla Berg-Weger, executive director of SLU’s Geriatric Education Center and professor of social work, will partner with multiple educational, patient care and service organizations in educating, studying and caring for older adults. COMMUNICATION WITH PARENTS OF SICK CHILDREN 3.26millionDr.VernaHendricksFerguson,theIreneRiddleEndowedProfessorofNursingatSLU,isaprincipalinvestigatorforthisfirstofitskindstudy.Thegoalofthefiveyearstudyistoseeifearlypalliativeandendoflifecarediscussionsatthetimeofachildscancerdiagnosiswillimprovethequalityoflifeforparentsandtheirchildren.NONADDICTIVEPAINKILLEROPTIONS3.26 million Dr. Verna Hendricks-Ferguson, the Irene Riddle Endowed Professor of Nursing at SLU, is a principal investigator for this first-of-its-kind study. The goal of the five-year study is to see if early palliative and end-of-life care discussions at the time of a child’s cancer diagnosis will improve the quality of life for parents and their children. NON-ADDICTIVE PAINKILLER OPTIONS 2.1 million Addressing the need for better pain medications, Dr. Daniela Salvemini and her colleagues at the Henry and Amelia Nasrallah Center for Neuroscience at SLU will investigate a promising pain-signaling pathway in the hopes of opening up a new avenue for pain medication research. CELLULAR CHANGES WITH HEART DISEASE, DIABETES 1.8 million Chemistry professor Dr. Jim Edwards (A&S ’99, Grad A&S ’01) received this National Institutes of Health grant to understand cellular changes that could lead to better therapies for diabetes and heart disease. Dr. Chris Arnatt, assistant professor of chemistry at SLU, is also a principal investigator. OBESITY, CANCER IMMUNOTHERAPY 1.7 million Dr. Ryan Teague, associate professor of molecular microbiology and immunology, will study how obesity influences outcomes for cancer patients being treated with immunotherapy. ANTI-DIARRHEAL DRUG 1.65millionAssociateprofessorofchemistryDr.MarvinMeyerswillusethisNationalInstitutesofHealthgranttofocusonintelligentdrugdesignfindingnewdrugsforinfectiousdiseasesthatkillmillionsandaredevastatingforthepoor.Dr.DaveGriggs,associateprofessorofmolecularmicrobiologyandimmunology,isanotherprincipalinvestigator.SLUStartupRaises1.65 million Associate professor of chemistry Dr. Marvin Meyers will use this National Institutes of Health grant to focus on intelligent drug design — finding new drugs for infectious diseases that kill millions and are devastating for the poor. Dr. Dave Griggs, associate professor of molecular microbiology and immunology, is another principal investigator. SLU Startup Raises 30 Million in Bid to Better Manage Pain In one of the biggest investments in research com-mercialization in Saint Louis University’s history, BioIntervene, a biopharmaceutical company founded in 2014 by SLU pharmacologist Dr. Daniela Salvemini has raised 30millioninseriesAfundingfromMPMCapital.TheinvestmentwillpropelSalveminisdiscoveriesforwardandsetthestagetobeginPhaseIclinicaltrialsforanewnonaddictivepainkillerlaterthisyear.Salvemini,whoisprofessorofpharmacologyandphysiologyanddirectoroftheHenryandAmeliaNasrallahCenterforNeuroscienceatSLU,pioneeredresearchonatreatmentforneuropathicpainthatcouldprovidethefirstalternativetoineffectivesteroidsandaddictiveopioids,amarketprojectedtoreach30 million in series A funding from MPM Capital. The investment will propel Salvemini’s discov-eries forward and set the stage to begin Phase I clinical trials for a new non-addictive painkiller later this year. Salvemini, who is professor of pharmacology and phys-iology and director of the Henry and Amelia Nasrallah Center for Neuroscience at SLU, pioneered research on a treatment for neuropathic pain that could provide the first alternative to ineffective steroids and addictive opi-oids, a market projected to reach 8.3 billion by 2024. Neuropathic pain affects between 15 and 20 million people in the United States. Exceedingly difficult to treat, this type of pain can occur after injuries to the nervous system due to trauma, disease or exposure to neurotox-ins, including after chemotherapy. There is a need for new medications that do not cause side effects and addic-tion the way narcotic pain killers do. “Having the opportunity to translate one’s discover-ies from the bench to the bedside is a dream come true,” Salvemini said. “I am hopeful that our efforts will lead to the alleviation of suffering while helping end the opi-oid crisis.” Salvemini discovered that alterations in signaling within the body contribute to the development of chronic pain states and that compounds that target a key recep-tor can “turn off” pain signals, providing relief from chronic pain of various types. This discovery, she noted, provided the starting point of her collaboration with Dr. Kenneth Jacobson, chief of the molecular recognition section, in the laboratory of bioorganic chemistry at the National Institutes of Health. Salvemini SUBMITTED PHOTO 6 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 7 ON CAMPUS SLU Research Institute Grants Second Round of Funding The Saint Louis University Research Institute awarded its second round of funding last summer: More than 740,000wasgivento13facultymembersthroughtheResearchGrowthFund.Morethan70proposalshadbeensubmitted.LaunchedinSeptember2018throughagiftfromDr.JeanneandRexSinquefield(CSB67)thelargestgiftinUniversityhistorytheSLUResearchInstitutefurthersSLUsgoalofbecomingtheworldsleadingJesuitresearchuniversity.ThefirstroundofgrantswasannouncedinJanuary2019,withatotalof740,000 was given to 13 faculty members through the Research Growth Fund. More than 70 proposals had been submitted. Launched in September 2018 through a gift from Dr. Jeanne and Rex Sinquefield (CSB ’67) — the largest gift in University history — the SLU Research Institute furthers SLU’s goal of becoming the world’s leading Jesuit research university. The first round of grants was announced in January 2019, with a total of 1.8 million going to 15 faculty members. Among the 13 faculty who received grants in this second round are: Miriam Cherry, professor and co-director of the William C. Wefel Center for Employment Law, who will study methods of online justice such as amateur sleuths gathering online to collect clues in cold cases, workers sharing information online about abusive labor practices and people using the Internet to mount harassment campaigns. Dr. Terra Edwards, assistant professor of anthropology, who will finish a book manuscript, Going Tactile: Life at the Limits of Language. Her research focuses on the protactile movement, which advances the claim that hearing and vision are not necessary for things like greeting people or joining or leaving a conversation. Dr. David Ford (A&S ’80), professor of biochemistry and molecular biology and director of the Center for Cardiovascular Research, who will use new technology to investigate endothelial and epithelial barrier dysfunction. This technology will be used in the planning for a SLU Sepsis Center and the SLU Institute for Drug and Biotherapeutic Innovation. Jesuits Reckon with the Legacy of Slavery In late August, Jesuits of the USA Central and Southern (UCS) Province began contacting individuals believed to be descen-dants of people held in slavery by 19th century Jesuits, including at Saint Louis University. This is the latest work of the Slavery, History, Memory and Reconciliation Project, which started in 2016 as a joint initiative of the UCS Province and the University. The goal is to find a path to reconciliation by illuminating the lives of the people who were enslaved and connecting with their descendants. Historians have long known that when Jesuits established mis-sions in St. Louis, they relied on the labor of enslaved people to help those missions survive. To reveal the stories of courage and resil-ience among those who were enslaved and to trace their families forward, researchers have combed through thousands of docu-ments, including financial ledgers, Church records and personal journals. Dr. Jonathan Smith, SLU’s vice president for diversity and com-munity engagement, is leading the project for the University. To undertake a conversation about SLU’s next steps, Smith plans to assemble a working group that will include students, faculty, staff, alumni, trustees and descendants. To learn more about the project and to read the stories about the people who were enslaved, visit shmr.jesuits.org. SLU Launches Geospatial Institute Anew Geospatial Institute at Saint Louis University will support research, training and innovation in the rapidly growing fields of geospatial science and technology. Also known as GeoSLU, the institute brings together faculty and students from various disciplines to use geospatial research tools to solve challenges and to enhance graduate and undergraduate education. The institute’s primary areas of research will include artificial intelligence, machine learning and informatics. In launching the Geospatial Institute, SLU seeks to strengthen collaborations with other universities, including the University of Missouri System schools, Washington University in St. Louis and Harris-Stowe State University, as well as innovation partners in the region, including Cortex and T-Rex. GeoSLU also builds upon SLU’s existing relationship with the National Geospatial-Intelligence Agency (NGA). In January 2019, the University signed a partnership agreement with the NGA, and the organizations partnered on the GeoResolution conference last April. Dr. Vasit Sagan, associate professor of earth and atmospheric sciences, is the institute’s faculty director. Robert Cardillo, former director of the NGA, advises the institute as part of his work as a distinguished geospatial fellow at SLU. For more information, visit slu.edu/geoslu. Nancy McNeir Ring Award Presented for Excellence in Teaching Dr. Katie Kelting, assistant professor of mar-keting in the Richard A. Chaifetz School of Business, was selected as the recipient of SLU’s 2019 Nancy McNeir Ring Award for excellence in teach-ing. Lauded by students for her emphasis on teaching them the value of ethics in the business world, Kelting joined the SLU faculty in July 2016 and is director of the business school’s Behavioral Research Lab. On a national level, she is a Women in the Marketing Academy Fellow, among her many fellowships. She addressed graduates during December’s midyear commencement at Chaifetz Arena. Kelting PHOTO BY STEVE LONG PHOTO BY STEVE DOLAN Special Guest Star: The Stanley Cup makes a stop on campus during Homecoming and Family Weekend 2019, giving fans of the 2019 NHL champion St. Louis Blues hockey team the opportunity to make lasting memories. SLU, Urban League Honor MLK’s Legacy At their annual memorial tribute honoring civil rights leader the Rev. Dr. Martin Luther King Jr. on Jan. 16, Saint Louis University and the Urban League of Metropolitan St. Louis honored those carrying forward King’s legacy of activism and advocacy for racial equity and justice across the St. Louis region. The keynote speaker, noted journalist and author Roland Martin, told the crowd in SLU’s Busch Student Center that “leaders step up when it’s time to lead.” He chal-lenged those attending the tribute to recall King not as a mascot, but for his radical commitment to social justice a

    University News - Volume 099, Issue 011 (March 5, 2020)

    No full text
    Special issue on the beginning of the COVID-19 pandemic. Mislabeled as Volume XCVIV. 24 pages.VOL. XCVIV No. 11 / March 05, 2020 COVER Design by Rebecca LiVigni UTHE UNIVERSITY NEWS Billikens abroad: International programs cut short amidst rising fear of virus T 02 NEWS Photo Courtesy of Riley Tovornik he outbreak of the coro-navirus variety COVID-19 that began in Wuhan, China last year and has since spread globally is now affecting the ability of study abroad programs to run safely. Although SLU has not cancelled its Madrid program, Spring Hill College and Loyola University in Chicago, through which 13 SLU stu-dents were attending universities in Italy, suspended their programs on Feb. 28. Most cancelled programs have been in Asian countries bordering China, such as Japan and South Korea, but a grow-ing number of universities have closed campuses in Italy, where over 500 cases of COVID-19 have been reported. These include universities like Elon University, New York University and Syracuse Univer-sity, all of which cancelled their programs in Florence despite only two recorded cases of COVID-19 in all of Tuscany. Oth-er universities have offered students the ability to transfer their credits or com-plete online courses upon returning. The University News contacted the President’s Office and Office of Interna-tional Services about SLU’s response to the spread of the virus and how it may STUDENTS ABROAD SENT HOME DUE TO CORONAVIRUS OUTBREAK By MIKHAIL FAULCONER Staff Writer affect students abroad. Rebecca Bahan, director of the Office of International Services, commented that at the time of publishing, 18 SLU students had their programs delayed, suspended or can-celled. Speaking on the SLU office’s ability to decide which students are required to return home, Bahan said, “SLU-Madrid is the only study program that’s operated by the University. Other study abroad programs are operated by partner uni-versities and organizations. None have indicated that they plan to cancel classes or close campuses, but we’re remaining in close contact.” Bahan also stated that the universi-ty recommends receiving all necessary immunizations before travelling, and it has been continuously supplying health information and tips for students in ad-dition to the enrollment of all SLU stu-dents abroad in an international health insurance plan. Three SLU students were affected by the cancellation of a program in Beijing on Jan. 28, including sophomore Jenni-fer Cheun, who spoke with the Universi-ty News. Commenting on the justifica-tion of cancelling programs, she stated, “I think that people being concerned is fair. People should take precautions, of course. But the flu has a higher mortality rate … I think people’s biggest fear is the unknown.” Cheun was disappointed with SLU’s response and lack of assistance. She said, “I had to do everything. SLU did not contact me whatsoever until I contact-ed them first ... I felt as if they were not much help. I understand that this was a first time event, but I am not kidding when I say that every other university that was affiliated with the program was more accommodating with their stu-dents than SLU.” Noah Elbert, a SLU sophomore who was studying abroad at the John Felice Rome Center through the Loyola Uni-versity Chicago program, commented on the effects the virus had on life in the city: “The only way that we have re-ally been affected here … is through the temperature checks mandated by the government, checking for fever condi-tions ... We also participated in a govern-ment- mandated informational session on the virus put on by Loyola.” Anna Burton, a SLU sophomore also studying at the John Felice Rome Cen-ter, elaborated on the anxieties the virus has caused, stating, “Everyone has been tense and on edge, especially since we get updates every hour about more pro-grams sending their students back or ris-ing numbers of cases.” Both Burton and Elbert agree that the virus seemed to have caused little con-cern in the local Italian population, and beyond temperature checks in some ter-minals and several train cancellations, there has been no major or evident in-terruption in the city’s daily life. “My personal opinion on the virus is that it is very much overhyped by the media, as many things are … I believe that this is a complete overreaction by universities whose members are not at risk really,” Elbert said on the subject of American universities’ reactions to the spread of COVID-19 and the cancella-tion of courses. Burton expressed a similar skepti-cism of universities’ decisions, com-menting, “From my point of view, I think it spreads panic and hurts the tourism and economy of the Italian communities to a stark degree. On the other hand, this is a public health con-cern and I understand wanting to put students health and safety as a number one concern.” As of March 3, SLU also suspended all university-sponsored travel to coun-tries with a Center for Disease Control Level 3 Health Notice, which includes Italy, China, South Korea and Iran. Additionally, the university asked all students, faculty and staff members to communicate their travel plans for the next month via a Google Form, stating that SLU will require any person who travels to a CDC Level 3 Health Notice country to be isolated at their home for 14 days before returning to campus. CORONAVIRUS BY THE NUMBERS South Korea 5,766 ITALY 3.089 IRAN 2,922 JAPAN 331 FRANCE 285 WHILE CHINA HAS BY FAR THE MOST CONFIRMED CORONAVIRUS CASES TO DATE, THE TOP 5 FOLLOWING COUNTRIES in confirmed cases are... 10k 20k 30k 40k 50k 60k 70k 80k 90k JAN 20 JAN 24 FEB 1 FEB 5 FEB 9 FEB 13 FEB 17 FEB 21 FEB 29 MAR confirmed cases mainland china total cases recovered confirmed cases other locations Confirmed coronavirus cases worldwide While cases in china have risen dramatically since the virus began, the amount of confirmed cases has been on the rise throuout the world as well. Infographic By Emma Carmody, Rebecca LiVigni / The University News Data from John Hopkins CSSE News 03 t the beginning of this semester, Club Resilient opened its doors to the SLU com-munity with a mission to em-power women through discus-sions on mental health. The idea was first brought forward this past summer by Megan Tweedie, a sophomore, and Audrey Williams, a freshman, after they both no-ticed a lack of community space devoted expressly to the discus-sion of mental health issues. “There are Active Minds and there’s other clubs that do a re-ally good job at educating people about mental health, but there wasn’t anything for people who were actually struggling with mental health … There wasn’t anything to bring those people together,” Williams said. The student-run organization is led by Tweedie, Williams and freshman Elle Flock. Echoing the words of her colleagues, Flock spoke on the importance and uniqueness of Club Resilient’s mission, stating: “There’s a dif-ference between knowing in the-ory that it exists and sitting down with a group of people that are all open about it, all not okay and willing to work on it together.” Club Resilient has a goal to not only try to improve mental health, but also to create a com-munity of acceptance and support through open conversation. Each meeting begins with an introduc-tion from each person in atten-dance as a means of building trust and familiarity with one another. Introductions are followed by a brief presentation of the week’s theme, given by Tweedie, Wil-liams and Flock. Some weeks, a personal experience or testimony related to that week’s theme is shared by a Club Resilient mem-ber. Testimonies are organized by participants writing their names next to the themes they’d like to speak on, or they can email Tweedie, Williams or Flock. On the weeks where there is no tes-timony, club members participate in some sort of group activity. The main mission of the club is to give every member access to a space where they can discuss their mental health. To conclude the meeting, each attendee is giv-en a small quote or tip to carry with them throughout the week. Summarizing the overall im-pact of Club Resilient, Tweedie said: “It just makes people know they’re not alone and that they actually can meet people that they can turn to [and] talk to.” Williams added: “Overall, it’s probably improved the SLU com-munity by building relationships, building conversation around mental health and hopefully im-proving people’s life in the reali-zation that they are not alone.” For any students interested in joining, Club Resilient meets ev-ery Wednesday at 6:15 p.m. in the KSLU lounge in the BSC. A he Women’s Foundation of Greater St. Louis rated Saint Louis University one of the best plac-es in St. Louis for women to work. The WFSTL sponsors several pre-mier initiatives and programs to bring awareness to issues facing women and help to create solu-tions and advance women’s ex-periences and economic success-es in the workplace. One of their main programs is the Women in the Workplace: Employment Scorecard Initiative. The Scorecard began in 2017, and it “recognizes employers who demonstrate a strong com-mitment to women in the work-place.” The criteria for recogni-tion includes: leadership roles for women, compensation, work policies that are flexible and pro-vide balance for employees, and female employee recruitment and retention initiatives. When asked about SLU’s hon-or as a top place for female em-ployees, Sara Rutherford, SLU ju-nior and Central Office Assistant in the Housing and Residence Life Department, said that she felt the designation was an accurate one. “These past three years work-ing at SLU will make it very dif-ficult to leave come graduation,” said Rutherford. “In my depart-ment especially, I have been fortu-nate enough to be surrounded by many accomplished, well-round-ed women in executive positions. With what they’ve taught me, I’m excited to move into the business world, and for those lessons I’m forever grateful.” This is the first time that SLU has been honored on the list, and the university will be officially recognized at the Foundation’s “Making a Difference” event lat-er this year. According to an in-terview with SLU Newslink, Lisa Dorsey, Ph.D., the SLU Women’s Commission 2016 Woman of the Year, co-creator of SLU’s women’s mentorship program and associ-ate professor of physical thera-py, “Being listed among the best places in St. Louis for women to work affords [SLU] an opportuni-ty to tell our story about the good things we are doing and highlight ways to continue to support and advance women.” The mentorship program Dorsey co-created is called Wom-en Leading Women, and its goal is to “support and advance the career advancement of women at SLU” by sponsoring a workshop focused on the interests of wom-en in higher education. Other initiatives at SLU fo-cused on gender equality in the workplace include the univer-sity’s family and medical leave policies, university task forces and an upcoming Faculty Fellow for Equity Issues, a position that will strive to “work closely with multiple university divisions and collaborate with faculty, staff and students.” The university also highlight-ed several outreach efforts in-cluding the “Get Her in the Game” program, designed to support female student athletes at SLU, as well as the free Well Woman clinic sponsored by the SLU Jesuit Health Resource Center. T (Rebecca LiVigni / The University News) SLU RECOGNIZED AS TOP WORKPLACE FOR WOMEN MENTAL HEALTH COMES FIRST: CLUB RESILIENT By SAVANAH SEYER Staff Writer By KLAUDIA WACHNIK Staff Writer (Jack Connaghan / The University News) News fter many weeks on the campaign trail, candidates running for Stu-dent Govern-ment Associa-tion positions were elected by SLU students on Feb. 25. The two contested races were for the positions of Presi-dent and Vice President of Aca-demic Affairs. For the position of President, Joseph Reznikov de-feated fellow candidates Maggie Kenney and Alhan Sayyed. For the position of Vice President of Academic Affairs, Sophia Izhar emerged victorious against op-ponent Faith Nixon. A majority of the votes for the election were submitted online through SLU Groups by students and tallied by the Election Commission. Reznikov said that he first heard the news of his victory on the night of the election after re-ceiving a call from current SGA President Maleah Fallahi and Election Commissioner Andrew Wagner offering their congratu-lations. The feeling Reznikov ini-tially had upon hearing the news was “complete honor” because “this community and this place means a lot to me,” he said. Now officially elected as SGA president, Reznikov’s main goal is to sit down individually with all of the vice presidents and talk about the visions they have for their roles. Stating that he sees the role of SGA president as “a visionary,” Reznikov said he wants to be able to support the goals and ideas of the Vice Presidents along with giving the student body a voice. When asked about his plan of action next year when in office, Reznikov said that he wants to “make strides with our Mental Health Task Force.” He pointed to how there were many mental health and wellness efforts hap-pening in various places on cam-pus. Reznikov’s plan would be to A 04 dents who are not involved in it.” Reznikov said he does not want SGA to feel intimidating, but in-stead to come across as an orga-nization that welcomes unique student experiences. Reznikov said he believes his perspective as an outsider of SGA, along with his knowledge of the internal work-ings of the organization, could help improve the perception of student government in the eyes of the SLU community. In regard to the recent adminis-trative turnover at SLU, Reznikov said that there are crucial con-versations to be had within SGA and the student body in general. “I think it’s really important to continue to be transparent with the rest of the student body about how SGA is handling some of these situations and what it looks like for us because students who are not involved in SGA should be SGA PRESIDENT-ELECT OUTLINES PLAN FOR SCHOOL YEAR By COLIN THIERRY Staff Writer just as involved in those process-es,” he said. For the most part, SLU’s SGA Election Day occurred with little controversy. There was a griev-ance filed about an Instagram post by Reznikov’s team which implied an endorsement by a non-CSO group. This broke an SGA Election rule, and the grievance was ruled on by Election Commissioner An-drew Wagner and SGA Moderator Jackie Weber. The Election Com-mission determined that the post should be taken down, and Weber, on appeal, asked Reznikov’s cam-paign to put forth an apology. The total vote counts will be released to the public, but not un-til the Election Commission’s full election debrief and report are finished. This process will take at least a couple more weeks, Wag-ner stated. centralize these mental health efforts and to let SGA be “the center” of those movements and “to continue to emphasize to ad-ministrators how much of a prior-ity mental health resources are to students.” Another goal for Reznikov next year as president is “to be very in-tentional about the students we put on university committees.” Reznikov said he wants to make sure that SGA is not picking the same students from the same ra-cial background, gender identity, major or ability to these commit-tees. Reznikov’s plan would be to pick students to university com-mittees who come with “unique and varying experiences within the student body” because a lot of times these students’ voices go unheard. Another issue that is import-ant to Reznikov’s platform as president is the proposed new core curriculum. With the way that the core curriculum is cur-rently crafted, Reznikov said he wants SGA to continue “to priori-tize student voices as the process goes on.” Additionally, Reznikov wants to make sure what is em-phasized in the current core plan continues to be emphasized once it is actualized. Reznikov’s approach to reach-ing his goals within SGA is best described as “very interpersonal.” “I think the best thing to do when stepping into a role like this is to take it on a day-to-day level and a person-to-person level,” he said. Reznikov maintained that it is im-portant to let people work on what they are passionate about, which would lead to tangible progress within SGA. One thing that Reznikov would want to change about SGA is how it “feels overwhelm-ing for stu- (Jack Connaghan / The University News) News 05 n Feb. 26, SLU students, faculty and staff gath-ered in the Saint Louis room to celebrate the 100th birthday of one of SLU’s most extraordinary alumni, Mary Bruemmer. Bruem-mer’s centenary celebration was well anticipated, with an exhibit documenting her life and legacy in Pius Library and a feature piece in SLU’s own “Legends and Lore” se-ries. Bruemmer’s legacy at SLU is difficult to overstate. She has been an inspiration to the SLU communi-ty for generations and has demon-strated the fruits that accompany a life dedicated to service to others. In an interview with the university, Bruemmer said of her abiding love for SLU and its mission: “There is a body of research that’s been done all over the world with all different cultures that finds that the happi-est people and those who live the longest fall in love with something and dedicate their lives, their time, their money to this one thing.” For Bruemmer, this “one thing” has been Saint Louis University, and she has certainly left her mark. To number Bruemmer among SLU’s most distinguished alumni is already to do her a disservice, for her connection and impact on SLU goes far beyond her undergraduate career. Born in 1920 in Madison, Illinois, Bruemmer enrolled at SLU in 1938. Her enrollment came at a moment in SLU’s history when women did not have access to the same educational opportunities as their male peers did. The year Bruemmer began her collegiate career, just five per-cent of SLU’s student population was female and women were not allowed to enroll in the College of Arts and Sciences. Entering instead the School of Education and Social Services, Bruemmer earned an A.B. in education, history and English. Despite obstacles, Bruemmer put together an illustrious under-graduate career, becoming the first female editor-in-chief of the Uni-versity News and earning straight A’s. Commenting on her ability to succeed in the face of daunt-ing obstacles, Bruemmer said: “I discovered that, in competing for acceptance, grades or honors, the secret was to act as if prejudice and discrimination did not exist, to presume that I would exceed and excel.” This mindset would continue to serve Bruemmer and her endeavors after SLU. Graduating in 1942 in the midst of World War II, Bruem-mer took a job with the Red Cross offering vocational counseling to veterans. In 1956, Bruemmer returned to SLU as the director of Marguerite Hall, an all-female residence hall at the time. In 1960, Bruemmer earned a master’s degree in edu-cation and would go on to serve as Dean of Women and later as Dean of Students. Throughout her career, Brue-mmer was at the forefront of initia-tives aimed at the empowerment of women, and her efforts directly or indirectly led to many of the things that SLU students today take for granted. As Dean of Students, she led efforts to open Oriflamme to women, a reform long overdue that strengthened the SLU communi-ty and its welcome initiatives. She founded the Women’s Commission a year later, an organization which “serves to promote the interests, issues and concerns of the women at the university” and to “educate, enrich and empower the women of Saint Louis University.” Bruemmer officially retired in 1990, but her impact and leg-acy continued to grow. She was awarded the university’s Fleur-de- Lis Medal upon her retirement, an honor bestowed on those individ-uals “whose contributions to the university reach far beyond the normal call of duty.” She received an honorary doctorate from SLU in 2000 and, in 2016, was honored with a papal knighthood, becoming Dame Commander of the Order of Saint Sylvester, Pope and Martyr. As the SLU community gath-ered to celebrate Bruemmer’s 100th birthday, this litany of accomplish-ments was honored alongside per-sonal anecdotes and memories of Bruemmer shared by alumni and faculty. Above all, the celebration reminded the SLU community that, as President Fred Pestello put it, “SLU will never be lacking for her presence.” O (Rebecca LiVigni / The University News) At 1:11 a.m. on March 1, DPS received a call from an RA of Griesedieck Hall after an odor of marijuana was detected from the hallway. DPS officers arrived on scene to find two smoke detectors covered with plastic bags. The two students present in the room ad-mitted to smoking marijuana, and all items were confiscated. At 1:20 p.m. on March 3, DPS responded to an auto accident in the Laclede Garage, which esca-lated into a physical altercation. A DineSLU employee and a SLU student were involved in a minor car accident which became an ar-gument, and DPS was called after the employee allegedly tapped the student on the head. At 5:23 a.m., a student called DPS because he was having an asthma attack in his room in Marchetti West. The student re-quested to be transported to SLU ER, and no Emergency Medical Service was needed. DPS REPORTS CELEBRATING 100 YEARS: THE LEGACY OF MARY BRUEMMER By CONOR DORN Associate News Editor 06 Arts and life By JACK JOHNSTON Staff Writer ho will tell your story? Unless you plan on writing down ev-ery single detail of your life in permanent ink, the facts, the motives and the perceptions of your life will probably be misconstrued. Joan of Arc was just a teenager when she was burned at the stake for being a witch, among other crimes. Who’s telling her story now?

    Universitas: the magazine of Saint Louis University

    No full text
    Summer 2020 issue of Universitas: the magazine of Saint Louis University. This is a special issue on SLU's response to the COVID-19 pandemic.SLU Responds to COVID-19 Editor’s Note Most of the content in this issue of Universitas was written and designed in May and early June 2020. It went to press on June 29. All attempts were made to ensure the content was accurate and as up-to-date as possible at the time of publication. However, in light of the COVID-19 pandemic, the status of certain projects and initiatives may have changed by the time the magazine arrives in readers’ homes. For the latest Saint Louis University news, please visit slu.edu. VOLUME 46, ISSUE 2 EDITOR Laura Geiser {A&S ’90, Grad ’92} ASSOCIATE EDITOR Amy Garland {A&S ’97} ART DIRECTOR Matt Krob CONTRIBUTORS Jeff Ackels {A&S ’17, Grad A&S ’20} Carrie Bebermeyer {Grad A&S ’06} Marie Dilg {Grad SW ’94} Amelia Flood {Grad A&S ’18} Jeff Fowler Sarah Hilgendorf Maggie Rotermund Michael Rozier, S.J. {A&S ’03} Nancy Solomon ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER St. Francis Xavier College Church and DuBourg Hall in the foreground with Griesedieck Hall’s windows lit in a cross pattern in support of health care providers and frontline workers Photo by Justin Barr Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to: Universitas DuBourg Hall 39 1 N. Grand Blvd. St. Louis, MO 63103 We accept email at: [email protected] Website: slu.edu/universitas Universitas is printed by Breese Printing and Publishing Worldwide circulation: 123,557 © 2020, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. Newspapers pile up in the lobby of San Ignacio Hall at the Madrid Campus during the COVID-19 pandemic. PHOTO BY ÁNGEL GARCÍA LÓPEZ Features Departments 6 HISTORY IN THE MAKING SLU’s president discusses the University’s response to the pandemic. — By Laura Geiser 10 VACCINE VISIONARIES Two top SLU scientists are investigating vaccines for COVID-19. — By Marie Dilg 14 FROM A DISTANCE SLU students and faculty adjust to distance learning. — By Amy Garland 18 HEALTH CARE FROM HOME SLU physicians and nurses treat patients via telemedicine. — By Maggie Rotermund 20 A GLOBAL RESPONSE SLU-Madrid faces unique challenges due to the pandemic. — By Laura Geiser 22 MISSION ACCEPTED SLU steps up to help others affected by the COVID-19 crisis. — By Staff Writers 26 THE BEST QUESTIONS A public health professor invites readers to think more deeply. — By Michael Rozier, S.J. 2 ON CAMPUS Rankings /// Core curriculum /// New interim provost /// Mary Bruemmer’s 100th /// Test-optional decision /// Campaign news /// Faculty Fulbright fellow /// Prospect Yards update 28 CLASS NOTES 31 IN MEMORIAM 33 THE LAST LOOK When we first laid out this issue, I planned to talk to you about the transformative development we are seeing in every direction we look. Every plot of land adjacent to campus is either being developed, about to be developed, or eyed by developers for future opportunities. While some of the most important projects are proceeding, the new SSM Health Saint Louis University Hospital and our new Interdisciplinary Science and Engineering Building first among them, much of the Midtown devel-opment paused in mid-March, just as we decided to send most of our residential students and the majority of our employees home and we pivoted to remote learning, remote working and telemedicine. At that point I planned to talk to you about the COVID-19 pandemic, the health and financial pain it has caused, how it has impacted our operations, and our plans to move forward on both the academic and medical sides. As we were getting ready to go to press for the second time, George Floyd was killed in Minneapolis. Once again, we pulled the issue back. In an instant, his name has become a rallying cry for justice and equality. The horrific scene of his death was livestreamed into the palms of people throughout the world. The cruelty and heartlessness we witnessed sparked global outrage. As I write, protests are taking place in every single state in our nation and in many cities through-out the world. The crushing pain felt by African Americans is once again on display. I have spoken to many who are part of our SLU community or our partners in the region. Our fam-ily members are hurting. They are angry, they are exhausted, they are fearful for themselves and those they love, and they want meaning-ful, structural change. We, non-African American members of SLU, are again called to stand with them as men and women for and with others. Like you, I have spent countless hours reading, watching, talking, ref lecting, and praying, looking for reasons to believe there is hope, that finally, this time will be dif-ferent. I believe that it will be if we do not lose the momentum of the moment. The momentum we wit-ness daily as neighbors across our nation come together in peaceful protest and advocate for long-over-due change. The momentum in which our Catholic, Jesuit univer-sity must play its role. As I look back over the past six months, we have whipsawed from celebrating the accelerating growth and momentum of Midtown and SLU to a hard stop to development and routine operations as a worldwide pandemic took hold. Then from the distancing and isolation of the lockdown to mass protests on an unprecedented scale in response to a crime documented on a ubiq-uitous video of the slow extinguishing of the life of a man pleading for relief and using his last breaths to call out to his deceased mother. I have repeatedly asked myself, “What are we called to do in the midst of these troubled times.” I keep coming back to one answer: We can make a difference. We must make a difference. The injus-tices and atrocities must end. Let us join together as OneSLU and do God’s work. It is the Jesuit way. It is the only way. Our next issue will report on what we are doing at SLU and what some of you, our justice-focused alumni, have done to be part of the solution. May God bless you and Saint Louis University. Dr. Fred P. Pestello President The publication of this alumni magazine has been delayed. Like my opening message to you, it has gone through three substantial changes in direction. These shifts reflect the painful times and unprecedented conditions under which we are currently living. PHOTO BY JAY FRAM PRESIDENT’S MESSAGE 2 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y SUMMER 2020 | 3 ON CAMPUS SUMMER 2020 | 3 U.S. News Ranks Graduate Programs at SLU Among the Best for 2021 More than 30 programs at Saint Louis University have been ranked in the U.S. News & World Report Best Graduate Schools for 2021, including a No. 1 ranking for SLU’s health law program for the 16th year. The rankings were released March 17. The Center for Health Law Studies in the School of Law has been listed as a top program since the rankings were first published. Three graduate programs in the Richard A. Chaifetz School of Business — entrepreneurship, international business and supply chain management — were ranked in the top 15. Among SLU’s medical and health professions programs, occupational therapy and physical therapy were ranked in the top 50, while medical primary care and medical research ranked in the top 75. In rankings for best education programs, SLU’s School of Education ranked No. 162 on a national list of 393 schools. Below are SLU’s Top 50 U.S. News graduate rankings for 2021. RANKINGS Wall Street Journal Ranks SLU on Top Midwestern College List Saint Louis University ranks No. 8 on the 2020 Wall Street Journal’s list of the top 10 colleges in big Midwestern cities. Once again, the Wall Street Journal/Times Higher Education list also ranked SLU No. 7 among the top 10 Catholic universities in the country in the annual ranking. The assessments were based on student outcomes, which include debt burdens and graduate salaries; academic resources for students; student engagement; and diversity. SLU Named Best Value College, Best Impact School by Princeton Review Saint Louis University was recognized by the Princeton Review as a 2020 Best Value College in its top 200 list announced Feb. 4. The Princeton Review chose the 200 schools based on its surveys of administrators at 656 colleges in 2018–19. Survey topics covered academics, cost, financial aid, career services, graduation rates, student debt and alumni support. SLU was also ranked No. 4 on this year’s “Top 25 Best Schools for Making an Impact” list. The ranking is based on student ratings and responses to survey questions covering community service opportunities at their school, student government, sustainability efforts and on-campus student engagement. LAW 1 HEALTH LAW 37 PART-TIME LAW HEALTH 34 PHYSICAL THERAPY 42 OCCUPATIONAL THERAPY BUSINESS 10 ENTREPRENEURSHIP 11 INTERNATIONAL BUSINESS 13 SUPPLY CHAIN 39 PART-TIME MBA 40 ACCOUNTING Undergrad Core Curriculum Approved In March, faculty approved the first University-wide core cur r iculum for undergraduate programs. Rolling out to students starting fall 2022, the core will offer a common intellectual experience for undergraduates and faculty, regardless of college, school or campus. SLU’s University Undergraduate Core Committee is working to implement the new approach to the undergraduate experience. Chief among the goals is to prepare “all students to be intellectually flexible, creative and reflective critical thinkers in the spirit of the Catholic, Jesuit tradition.” The committee says the new curriculum also will “nourish students’ minds, hearts, souls and well-being, and guides them in discerning how to use their talents for the good of others and find God in all things.” “We are not doing core reform, but core inven-tion,” Dr. Ellen Crowell, director of the University Core, said. “We worked together to build something from scratch. [The fact that] we all came together and adopted a shared structure is a testament to how much the SLU community cares about undergradu-ate education and the SLU student experience.” Look for more details on the new core curriculum in a future issue of Universitas. Standardized Testing Now Optional Saint Louis University has moved to a stan-dardized test-optional admission process for all undergraduate and most graduate programs beginning with students applying for the 2021-22 academic year. Test-optional means that prospective students may submit standardized test scores, but those who choose not to will not be disadvantaged in any way in the admission process. For students applying for the fall 2021 term, SLU will not require ACT or SAT scores for freshman or transfer applicants, and will not require the GRE or GMAT for most graduate programs. Due to accreditation requirements, a few graduate and professional programs, including law and medicine, will still require pre-admission tests. English profi-ciency tests will still be required for international students. Though the test-optional admissions option is spurred by COVID-19 forcing many test date cancel-lations, University leaders believe the decision will serve as a catalyst to make a SLU education more accessible and bolster diversity among students. “Studies show that a prospective student’s high school grade point average is a much better predictor of college success than standardized test scores,” said Kathleen Davis, vice president for enrollment and retention management. “We also know that stan-dardized tests have historically disadvantaged those students with lower family incomes and less access to expensive test preparations services.” LEWIS NAMED INTERIM PROVOST Dr. Michael Lewis is the new interim provost for Saint Louis University. His term began July 1. It is a role Lewis is familiar with, having served as SLU’s acting provost at the end of 2018. Previously he was associate provost for faculty affairs and development, and an associate professor of chemistry. He has been at the University since 2004. During the 2019-20 academic year, Lewis was interim dean of the College of Arts and Sciences. He replaces Dr. Chet Gillis, interim provost since January 2019. INTERIM DEAN FOR A&S Dr. Donna J. LaVoie, associate dean and professor of psychology, is the new interim dean for the College of Arts and Sciences. She has been with the University for more than 20 years. Spanish Professor Awarded Fulbright Fellowship Dr. Julia R. Lieberman, a professor of Spanish in SLU’s Department of Languages, Literatures and Cultures, has been named a 2020-21 Fulbright scholar. She will spend the first few months of 2021 in Portugal. Her project is a book-length work, Few Wealthy and Many Poor: London’s Spanish-Portuguese Jewish Community in the Eighteenth Century. Lieberman, who has been at SLU since 1995, teaches courses in Spanish language, and Renaissance and Baroque Spanish literature, as well as courses about London Spanish-Portuguese (Sephardic) Jewish life. The Fulbright fellowship runs from January to July 2021. Lieberman will be in residence at the University of Lisbon Department of History from February to the end of April. SLU Celebrates Bruemmer’s 100th Birthday Well-wishers including University leaders, stu-dents, faculty and staff members, trustees, alumni and family packed the St. Louis Room in Busch Student Center on Feb. 26 to help Dame Mary Bruemmer celebrate her centennial birthday. Among those who came to celebrate Bruemmer were the “Marguerite Girls,” guided by Bruemmer during her years as SLU’s dean of women; members of Oriflamme, the group of student leaders she advised for many years; and University President Dr. Fred P. Pestello. “Mary, wherever you are in the world, you will always reside within the hearts of those bold enough to don the fleur de lis, share the gratitude of Oriflamme and proudly proclaim, while winking, that they are a Billiken,” Pestello said in his toast. Bruemmer (A&S ’42, Grad Ed ’60), an administra-tor and unmatched University supporter for decades, received birthday wishes, exchanged stories with friends, students and colleagues, and thanked those gathered for their birthday wishes. Just 18 months into the public phase, the University’s comprehensive fundraising campaign, Accelerating Excellence: The Campaign for Saint Louis University, is almost 80% to the 500milliongoal.ThecampaignaimstopropelSLUtonationalprominenceasaworldclassresearchuniversitythroughstrategicinvestment,focusingonacademicexcellence,scholarships,healthsciences,athleticsandbusinesseducationasthetoppriorities.However,fortheforeseeablefuture,thecampaignispivotingtofocusonscholarshipsandstudentemergencyreliefeffortsinresponsetoCOVID19.ThepandemichascreatedmanyfinancialhardshipsforSLUstudentsandtheirfamilies,andtheSaintLouisUniversitycommunityiscalledtohelp.ReturningtoSLUthiscomingfallwillbeachallengeformanyofourstudents.Nationaltrendsindicatestudentscouldneedanaveragefinancialaidincreaseof5thisunforeseen500 million goal. The campaign aims to propel SLU to national prominence as a world-class research university through strategic investment, focusing on academic excellence, scholarships, health sciences, athletics and business education as the top priorities. However, for the foreseeable future, the campaign is pivoting to focus on scholarships and student emergency relief efforts in response to COVID-19. The pandemic has created many financial hardships for SLU students and their families, and the Saint Louis University community is called to help. Returning to SLU this coming fall will be a challenge for many of our students. National trends indicate students could need an average financial aid increase of 5% to 7%. To bridge this unforeseen 22 million demand on the University’s resources, donors are encouraged to support SLU’s Accelerating Access Fund, which provides scholarship aid to the students most in need, or the Student Emergency Relief Fund, which provides support to students experiencing unexpected financial need beyond tuition costs. To support funds like these, please visit giving.slu.edu/oneslu. PHOTO BY LUKE YAMNITZ 4 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y SUMMER 2020 | 5 ON CAMPUS As work continues in Prospect Yards near Saint Louis University, a few locations have new completion dates as well as updates about what to expect when construction is finished. A. THE ELEMENT BY WESTIN HOTEL The Element by Westin is set to open in September. This extended-stay facility, just a short walk from campus on Forest Park Avenue, will cater to travelers and families. It will feature a Motion Fitness Center, an all-natural saline pool, a bike borrowing program and a rooftop bar. Developed by Midas Hospitality, the six-story hotel will not only include some traditional hotel features, but also allow groups to spend time together in a private setting. The Element by Westin’s 153 suites offer spa-inspired bathrooms and the Westin’s signature Heavenly Beds. Each suite includes four guest rooms that share a fully equipped kitchen and a living room area. The hotel will begin taking reservations later this summer. B. THE NICHOLAS BUILDING At the corner of Park Avenue and Grand Boulevard, the Nicholas Building awaits consideration for a spot on the National Register of Historic Places. When the five-story building was constructed in 1913, it contained shops on the first floor and offices on the upper levels. The building also was home to the SLU Doisy College of Health Professions until 1998, when the new Allied Health Building opened. Although the Nicholas Building has undergone renovations over time, it has maintained historic plaster ceilings, sills, casings and window trim. The rehab will provide space for a variety of tenants, including restaurants, coffee shops, offices and even apartments. C. CITY FOUNDRY STL One of the most anticipated developments near SLU, the City Foundry STL will comprise a food hall and entertainment venues, such as Punch Bowl Social, as well as office space. The development is located at Forest Park and Vandeventer avenues. Office tenants are anticipating moving in this summer, with entertainment and food venues to follow. — By Jeff Ackels PROSPECT YARDS DEVELOPMENT CONTINUES A C B Rendering of the Element by Westin Hotel City Foundry STL The Nicholas Building SLU men’s basketball junior guard Jordan Goodwin was named to the National Association of Basketball Coaches (NABC) All-District 4 first team, as selected and voted on by member coaches of the NABC in NCAA Division I. A first-team All-Conference and All-Defensive team selection by the Atlantic 10 Conference, Goodwin led SLU with 15.5 points per game. He also was one of the top rebounding guards in the country with 10.4 rebounds per game, which ranked in the top 25 nationally. Goodwin ranked 24th in the country in steals with 64. A total of 104 SLU student-athletes were recognized during the annual Straight-A Celebration, highlighting the Billikens who received straight A’s in the spring 2019 semester and/or fall 2019 semester. This year, the student-athletes recorded video messages expressing gratitude to faculty members who made an impact on their academic pursuits. Billiken Briefs SLU’s Argus-2 Satellite Launched The Saint Louis University-built Argus-2 satel-lite successfully launched into orbit from the International Space Station (ISS) on Feb. 19. The satel-lite was built by a team of faculty and students at Parks College of Engineering, Aviation and Technology. The campus community joined students and fac-ulty in McDonnell Douglas Hall to watch the launch, which was also a milestone for NASA. With the deployment of satellites from the ISS, the agency celebrated 100 CubeSat launches through NASA’s Educational Launch of Nanosatellites (ELaNa) program. A CubeSat is a small satellite that plays a valuable role in NASA’s exploration, technology, educational, and science investigations. The Argus-2 was the 99th launch. The team behind the Argus-2: (FROM LEFT) Dr. Michael Swartwout, associate professor of aerospace and mechanical engineering, and Parks students Connor Highlander, Sergio Bernabeu Peñalba, Jeffrey Kelley and Andrew Wagner. PHOTO BY MAGGIE ROTERMUND SLUCare Facilities Update SLUCare physicians and staff will move into new and renovated facilities next to the new SSM Health Saint Louis University Hospital, which opens on Sept. 1. These include a new state-of-the-art clinical practice facility and the renovated former Imagine School Building at Chouteau Avenue and Spring Street, which will house the academic offices of SLUCare physicians. The new clinical practice facility, named the SLUCare Center for Specialized Medicine, is located at 1225 S. Grand Blvd. The renovated building for physician academic offices is now the SLUCare Academic Pavilion. The address is 1008 S. Spring Ave. There have been extensive renovations to the building during the past year in preparation for the move and opening of the other facilities. 2020 Graduates ‘Honor the Day’ Though Saint Louis University’s May com-mencement ceremony was postponed due to the COVID-19 pandemic, members of the class of 2020 marked the original date of graduation with an “Honor the Day” online event on May 16. As part of the digital celebration, graduates could add special frames to their social media profile images, dress up their social media posts and stories with SLU-themed stickers, participate in digital games, and share memories while tagging friends. In addition, more than 150 faculty and staff created congratulatory videos that were released on May 16. Both the May and December 2020 ceremonies will be post-poned until May 2021. Though the details about exact dates are still in the works, there will be separate ceremonies for the dif-ferent graduating classes. SLU Creates Addiction Medicine Fellowship Saint Louis University School of Medicine is tack-ling the country’s opioid abuse crisis by training community physicians to recognize and trea

    0

    full texts

    46,011

    metadata records
    Updated in last 30 days.
    Saint Louis University Libraries Digital Collections
    Access Repository Dashboard
    Do you manage Open Research Online? Become a CORE Member to access insider analytics, issue reports and manage access to outputs from your repository in the CORE Repository Dashboard! 👇