1,792,070 research outputs found

    Muriel Spark as auto-biographer in <i>Curriculum</i> <i>Vitae</i>

    Get PDF
    Examining Muriel Spark's main aims as an auto-biographer in her work Curriculum Vitae brings important resources in the exploration of the genre of autobiographical writing. This with the theoretical engagement, allows consideration of the critical issues surrounding the roles of author and reader in the construction of the literary self. Spark demands the reader participate in the constructon of textual meaning; overturning the conventions of autobiography, satirising its claims to omniscience and highlighting the impossibility of an authentic voice with regard to the self

    SPARK Digital Commons

    Get PDF
    SPARK: Scholarship, Publishing, Arts, Research, and Knowledge Institutional Repositories (IRs) like SPARK showcase and preserve a university\u27s scholarship and creative work under one umbrella. Because SPARK is search optimized as well as open access, its works are easily discoverable and viewed on the web, “extending Bethel’s reach and reputation” on a global scale, as the map dashboard dynamically illustrates. And with each download, citation count, and pageview, Bethel’s scholarship rises higher within Google’s rankings. Authors receive monthly statistical reports of these interactions. SPARK provides a stable web address and improved management of scholarly resources for Bethel departments. Today we are showcasing how SPARK can be used for Events like the Day of Scholarship

    The Spark, Volume 6, No. 3

    No full text
    TIie lpark Number 3 Volume 6 CENTRAL PIEDMONT COMMUNITY COLLEGE Wednesday, November 25, 1981 Taylor Hall 102 Charlotte, North Carolina (704) 373-6751, 373-6665 Changer causes problems by Victor Alexander Spark Staff Writer If you've been one of those people running around Taylor Hall scrapping for change, then you are probably wondering why the change machine in the recrea­tion room is still "out of order." The changer, valued at over $1200, was installed in August of this year and burglarized shortly thereafter. Since then it has not been placed back in operation. When installed , the machine's security setting was set at "low," allowing the machine to accept bills without electronioally scan­ning them to make sure they were genuine. Dr. Mel Gay,'Vice-President of Student Services was not aware that the changer was still out of order. He thought it was working properly. Gay said "immediately after the machine was burglarized last quarter, the change machine company was informed and the machine's errors were corrected with no problems." Ross Surphlis, Director of Student Activities had the bill reader removed to be repaired. He stated that there are several other things to be taken care of and he has not made any deci­sions of yet, on the future of the changer. Surphlis added that the money from the machine in the recreation room is student Change machine in Recreation Room, Taylor Hall Spark Photo by Cheryl DesAutels money, and when me macnme who drive to school and play comes up short, the State Audit games in the recreation room will wants answers. have to bring money from home So, as it stands now, students because change is unavailable. Learn at home by Bill Broussard Spark Staff Writer Now, in the privacy of your own home, you can earn college credit simply by watching TV. Instructional Options Unlimited (IOU) coordinates the non-traditional learning opportunities already provided by several different media. IOU brings education to the student through television, telephone, and radio, thus enabling self-paced learning. This quarter, thirteen courses hit the air at local stations. On Aug­ust 31, Charlotte Cable 3 began broadcasting daytime courses distribu­ted through the Appalachian Community Service Network (ACSN), a private non-profit corporation that grew out of the Appalachian Regional Commission. These courses include Applied Sketching Techniques (ART 7058-80), Marketing Perspectives (MKT 1304-80), Writing For A Reason (COM 1304-80) and Keep It Running (AUX 7020-80). Channel 58, an affiliate of Public Broadcasting Network began airing the course, Personal Finance & Money Management (FIN 1500-80) on September 5. On October 5 and 6, Channel 42 started their home television courses. They include American Politics (POL 1502-80), Your Health Your Choice (HED 1310-80), Mathe tics For Modern Living (MAT 1500-80), Understanding Human Behavior (PSY 2504-80), Consumer Education (CED 1500-80), Reading Improvement (RDN 9510-80), Introduction To Computer Concepts (EDP 3300-80), and Introduction To Business (BUS 1400-80). College credit is available to students who register and meet the requirements for the courses, including exams given in the Testing Center (4th floor LRC). The LRC's first floor provides a Telecourse Center in which students can gain instruction from qualified teachers and pick up or listen to any course material he or she missed. If you would like more information on how to collect your IOU, phone Cindy Wilson at 373-6462. •••••••••• "The Spark" is still in need of 1 students who are willing to devote · some time and effort into putting together an inform­ative newspaper. Meetings are held Tuesdays at 2:30 in room 102 Taylor Hall. If you would like to participate in any phase of the newspaper, then drop by the student activities office (TH 102) or call 3 73-6665. Student Publications welcomes classified ads from the CPCC community. ff you have an ad to be subrnitted, bring it by room 102 Taylor, or call 373-6665. THE SPARK is a student publication, financed by student activity fees and written, edited and published by stu­dent journalists for the CPCC commu­nity. It is not an official College publi­cation, and viewpoints expressed herein should not be interpreted as represen­ting official CPCC positions. Editor . ...... Brenda K. Beaver Photo Editor . . Cheryl DesAutels Staff Writers Gloria McMillan Joseph Sovacool Barb Washington Eugene Mathis Bill Broussard Jim Brock Cheryl Lemmond Victor Alexander Typesetter . ...... Lynn Corzine Mgr. of Student Publications . ... Darrell Gray ••••••••••• OOPS! The Talking Hands Club was accidentally cut from the list that appeared in the last issue of The Spark. The club which is made up of deaf students and interpreters was formed during summer quarter '81. · Club News . Campus Ministry Active by Cheryl Lemmond Spark Staff Writer Two individual religious clubs have pooled some resources and will now function under an um­brella organization to be known as United Campus Ministry. The two clubs, Baptist Stu­dent Union and Catholic Campus Ministry, will remain as separate entities with separate activities but will coordinate some efforts under the leadership of David Upshaw, newcomer to the col­lege. Catholic Campus Ministry, (CCM) is "interested in anyone, regardless of church affiliation". They are concerned with " finding a deeper and more mean­ingful relationship with the Lord through discussion, scripture study, prayer, and fellowship." Anyone wanting more infor­mation about CCM should meet in MH 110 Tuesdays at noon or phone Sister Mary Agnes Solari at 825-5126. The Baptist Student Union (BS U) also welcomes any religious affiliated student to "join in Christian fellowship." BSU meetings, held weekly on Wednesdays at noon in the fourth floor conference room of the LRC, include songs, speakers , films , and discussions. There are also workshops, retreats, and conventions to attend, all provi­ding interesting experiences. BSU is involved with commu­nity service projects and nation­wide student mission opportuni­ties. Don Rodgers is the BSU cam­pus minister and can be reached through the Drop-in Cen­ter, or called at 597-2344 or 545-6274. Ginny Bates, club advisor, is available at 373-6754. The two combined groups are putting together a Moravian Love Feast to be held on Dec.2 in the Pease Conference Room of the LRC at noon. The entire college commun­ity is welcome to attend. Job requirements discussed by Cheryl A. DesAutels Spark Staff Writer A three member panel from Duke Power Company discussed requirements for employment and training methods used by Duke Power at the Data Processing Management Association meeting held on November 3, 1981. Ray Hodge, Supervisor for the Software Support Group of Steam Production, mapped out Duke's requirements on hiring and ad­vancement levels. "We look for a good basic two-year degree in Computer Science," said Hodge, "and train from there in an entry level program for three to six months." Hodge stated that after training an employee can advance to Assistant Programmer, then Programmer. After achieving Senior Program­mer status, the position of Team Leader of a software support group is available. The DPMA meets every first and third Tuesdays of the month. The Apple Microcomputer will be the next major discussion topic. HMRA travels to Grand Strand by Cheryl Lemmond Spark Staff Writer The Hotel Restaurant Man­agement Association (HRMA) traveled to Myrtle Beach October 22 to spend two days at the South Carolina Food Service and Education Exposition . . The stud en ts were involved in a cookout on the beach upon their arrival. At the Sea Cap­tain's House, owner Bob Chap­man spoke to the studenb at length about costs, management problems, and other related sub­jects. Steer's Calabash Number Two. 2001 hosted the students all three nigh ts. There will be more shows in the coming months. The Lovefeast is a traditional war· ship service of the Moravian Church which seeks to strengthen the spirit of unity and goodwill among men. "It is a time to relate together as individuals in a religious experience," according to David Upshaw, adviser of Campus ministry. Everyone is invited ta attend the Moravian Lavefeast which will be led by Rev. Herbert Weber, pastor of The Little Church an the Lane. Officers chosen by Cheryl A. DesAutels Spark Staff Writer New officers of the Graphic Arts Junior Craftsmen Club were selected as a result of an election held at the October 29 meeting. New officers are : Presid ent, Benny McCaskill; Vice President, Shari Schundlemire ; Secretary/ Treasurer, Sheryl Torrence and Sergent-at-Arms; Jeff Novick. The Junior Craftsmen Club hosts guest speakers and takes field trips to familiarize the stu­dents with different aspects of the printing industry. Greg Hyslop Artist in Residence by Gloria McMillan Spark Staff Writer Jazz guitarist Greg Hyslop is the artist in residence here for academic year 1981-82. The 29-year old Berklee College of Music graduate debuted here Oct. 14 in the Music Hall for the opening Wednesday Fall Quarter Reci-tal Series. · · Recently chosen as a resident artist for the N. C. Arts Council and the Department of Community Colleges, Hyslop said the purpose of his sponsoring program is to supplement and enhance local community arts and resources. Spark Photo by Cheryl DesAutels During his nine month stay at CPCC Hyslop wants to expose students to different kinds of art, besides what is already on campus. He would like to see more jazz artists from other schools in the Wednesday music series. Hyslop will be available to local schools and civic groups as well as to CPCC classes for speeches and performances. Hyslop's earlist influence in the music world was his father, who played country music. While he was growing up, he played in talent shows ,and contests with friends. Later he joined a rock band which he stayed with for two years. He then moved to Boston where he obtained his music degree in 1976. Others who influenced his music were Wes Montgomery, Charlie Parker, and singer-guitarist George Benson. Restaurant Review BY Cheryl A. DesAutels Spark Staff Writer This is part of a series of articles on places to dine around campus. In each issue, a different restaur­ant will be featured. Spark Editor Jimmie's Restaurant located dir­ectly across from the registration center is a great place to "munch out" if you have plenty of time between classes. They have a choice of six daily specials which are changed every day. Forexample,onaThursday you'll find Roast Sirloin of Beef w/gravy (includes choice of two vegetables and a roll) but not nec­essarily on a Tuesday. You '11 also find five different cold plates which includes slaw, potato salad and crackers. A daily soup-and­sandwich is also featured. The CPCC Special (what else?) is a salad, baked potato and fountain drink. If you're not into specials they also have the regular selec­tions from the grill, sandwiches, hoagies, and, for those of you who can manage it, tripledeckers. Got any more room? Try the desserts (homemade cheesecake is the feature). They have the nor­mal range of beverages. A plus is the coffee (unlimited refills) . Well, they might cut you off if you start to slosh. For the "Happy Hour" people, beer and wine are served. Of course, if you're in a hurry, pass this up. Service is slow, pos­sibly due to the heavy traffic jams that occur, but the waitresses are mostly congenial. Jimmie's is open from 6 am to 10:30 pm Monday-Friday. So night students, you can have a stab at this one

    Aeronautic Spark Plugs

    No full text
    This mounted collection of aeronautic spark plugs illustrates one phase of the extensive program on ignition apparatuses at the National Bureau of Standards (NBS) which was sponsored by the National Advisory Committee for Aeronautics (NACA) from 1917 to 1925. During that time NBS ceramic chemist Albert V. Bleininger and the Frenchtown Porcelain & Champion Spark Plug Companies developed ceramics low in sodium and potassium which could therefore maintain higher electrical resistance at operating temperature in aircraft engines. The work was later extended to studies of various magnetos, spark coils and other ignition apparatuses; Frank B. Silsbee, Hobart C. Dickinson, R.B. Brode, V.W. Randolph, P. Agnew and several other National Bureau of Standards scientists and engineers were involved.25 x 66 x 6 cm; Average spark plug: 8 x 2 x 2 c

    The Spark, Volume 7, No. 2

    No full text
    TIie lparll Vol. 7, No. 2 Feb. 28, 1983 CENTRAL PIEDMONT COMMUNITY COLLEGE Taylor Hall I 02 Charlotte, North Carolina (704) 373-6751, 373-6665 THE BELK BUILDING ... grant brings name change Colleges Come To Woo CPCC Students Betsy Bowen SPARK Staff Writer Where do you go from here? If you were in the gym January 28th at 11 :30 a.m., then you had the chance to answer that question with the aid of more than forty representatives from approximately 38 colleges. The action began with free coffee and donuts for the guests from other colleges, and lasted until around 1 :00 pm. Pamphlets vividly displayed the individual school's re­sources while representatives went on to explain details, point out advantages and advise students on various programs. Some students marveled at the options given to them. For example, did you know that at Warren Wilson College a student is automatically eligible for a scholarship if he or she has a grade point average of 3. 72 Plus, the scholarship is in addition to a room and a meal plan. Quite an array of colleges attended the assembly. Large universities stressed their wide range of programs, enormous campuses and that certain prestige that goes along with attending a big, well-known university. In turn, the smaller colleges brought to students' attention a "personal"education with individual help in courses, and the "everybody knows everyb()dy else" closeness on cam­pus. Representatives pushed pamphlets, papers, and pens revealing twenty reasons why you need their college. Older schools showed information with pictures of cathe­dral- like buildings against a deep blue sky. Newer institu­tions portrayed. fresh new starts with somewhat futuristic buildings. "Any students transferring to another college or furthering their education needs a one-on-one session like this to really find out what other colleges can offer them," says Robert Barkley, representative for Lenoir­Rhyne. Surprisingly enough, it seems as though all col­leges were able to offer financial aid and student loans to newcomers. Every college, from Tennessee, across our state and down through South Carolina, was represented. The few and the proud were not left out. Three of the big four were there, Army, Air Force and Marines, not to mention the Air National Guard. The Navy took a raincheck . George Dixon from North carolina State Univer­sity, concluded, "Mariy questio ns were answered ... each student is in a different situation, they needed answers to their own problems that are impossible to cover in a standard pamphlet." No matter what program students were interested in, the question of the day seemed to be: from the male students, "Are there more girls than guys at your college?", and from the female students, "Aren't there about two or three guys to every girl at that col­lege?". 'At any rate, colleges in attendance were well represented and students received answers to many of their questions. Sharon Berry SPARK Staff Writer Recent ly, the Photography Guild held a logo design competi­tion . The assignment to come up with a logo was given to the typography class. Each person had to come up with their own design. The design had to be original, having included "The Photography Guild of CPCC." Two hundred designs were entered. The Logo Race Sincere congratulations go to the winner, Andrea Barksdale. An­drea received 25 for her beautiful logo. lhe ltl.CI.W:I PHOTOGRAPHY GUILD of CPCC The story behind the design is quite interesting. The series of ru n­ning horses is a symbol of photog­raphy. ====--- ---------~ --~ --- - Edward Muybridge is well known for stop-action photography. He was the first person to use stop­action photography. It began when he was commissioned to prove a bet that all four of the horse's feet are off the ground at the same time. As you can see, the logo is a truly meaning­fu l a nd historic piece of art. ·Students Celebrate Black Heritage Week f' By Mischelle L. Byrd \___ SPARK Staff Writer Annual Black Heritage Week was celebrated on the CPCC campus the week of February 14. The theme for this year's program was, "We've Come This Far By Faith." The program highlighted the achievements and setbacks of many famous black Americans covering a span of time from slavery days to the Civil Rights Movement. The events began on Monday with the reading of the Proclamation and the presentation of an array of dis­plays in the mall area. On Tuesday, an inspirational message was delivered by the Reverend Raphael Green, a native of Missouri and a recent graduate of Oral Roverts University. Reverend Green has been traveling exten­sively for three years. His stops have included points in Canada and the Carribean. On Wednesday, a genealogy workshop was held. The Forum cafeteria sponsored an Afro-American Cuisine Day on Thursday, featuring various traditional dishes. And on Friday, Bishop J.H. Sherman spoke at Little Rock AME Zion Church. Bishop Sherman is a member and officer of the Church of God in Christ- the largest Black Pentecostal Church in the world. CPCC Gets 100,000 By Terrie A. Cureton SPARK Staff Writer The John Belk Foundation donated 100,000 to Central Piedmont Community College for the purchase of instruc­tional computers. These computers will be used to update the resources instructors use for their materials. Powell Majors, director of the CPCC Foundation says, "The instructional computers are needed to aid the instructors so that they can refer to new and better information." The computers will be located in Mecklenburg Hall, Kratt Hall and the Belk Building. The departments that will-be using the computers include Writing and Humanities and Mathe­matics. The Board of Trustees changed the name of the Career Education Building to the Belk Building because of the interest the John Belk Foundation had in the medical field. "The Belk family is well known in the community," says Powell Majors. ' "They give donations and contributions to hospitals and other institutions for higher education." Mr. Tom Belk has served on {' the Board of Education. Powell Majors says that he is very thankful that the John Belk Foundation chose Central Piedmont Community College for the 100,000 contribution. Other features of Black Heritage Week included gospel singing by various groups, including the Gospel Travelers, and John Key and the Key Singers. There were also black heritage films on reserve in the Learning Resources Center during the entire week. All in all, it was a tremendous undertaking, and an excellent way to honor America's black leaders. STAFF Editor ...... David W. Richardson Associate Editor . . Jonathan Davis · Assignments Editor ..... Victor D. Alexander Photo Editor . . . . . . . Betsy Bowen Distribution .... Mischelle L. Byrd Writers: Sharon Berry Terry Cureton Terry Gray Sandra Hill Billy Spann Denise Stinson Tony White Photographers: Mike Brown Andrew Gibbon Ronnie Sherrin Greg Yeager Typesetter: Monica Rankin Manager-Student Publications: Darrell Gray PQ LI CY The Spark is a Student Publication, · financed by student activity fees, written, edited and published by student journalists for the CPCC community. It is not an official col­lege publication, and any viewpoints expressed herein should not be interpreted as representing official CPCC positions. The Lady Tigers Bare Their Fangs! by M ischelle L. Byrd SPARK Staff Writer This year's womens basketball team opened the season by playing various colleges within the Carolinas, including Sacred Heart and Denmark Technical College. The Lady Tigers practice an average of eight hours a week, and the team consists of nine very talented young ladies, including Marjorie McCullough, who averages 18.6 points per game, Debra Outer, who averages 15.2 points per game, and Elaine Wolf and Gail Coleman, both of whom hold a 10.0 average per game. The Lady Tigers hold a record of 2-4, but their graceful moves up and down the court show that they have a great determination and eagerness to win. They showed off their great athletic abilities on Saturday January 15, 1983, when they battled Sacred Heart College. The Lady Tigers fought a long and hard battle, using exciting plays and swift moves which kept the spectators on the edge of their seats. Marjorie McCullough dribbled down the court, putting the ball through the hoop with a sensational jump shot, while the other team members provided excellent pressure defense. Great floor performances and cohesive team work showed that the Lady Tigers have a lot going for them. With the shooting of Marjorie McCullough ( 17 points) and Elaine Wolf (8 points), the Lady Tigers kept the score close. By the end of the fourth quarter the Lady Tigers had already pushed their way to victory. 35-33 was the ending score that took the Lady Tigers to the locker room. So a word to the ""ise: "Watch out for the Lady Tigers-they're HOT!!" EDITORIAL ... by David W. Richardson SPARK Editor Dear Readers: To be honest with you, I am amazed that so many people seemed to take my story, "The Best Defense", so seriously! It was not my intention to offend anyone, least of all any member of the female population. I have not, nor will I ever, endorse the use of violence. In fact, the purpose of my article was to spotlight a very good class available to help people learr, to defend themselves against violence; apparently-, I have failed you in that respect. In past issues I have tried to interject a little humor into the SPARK. It had been my goal to inform and entertain you at the same time. My ultimate aim was to serve your needs. I'm sorry if I have let you down. Writing is all I have ever been able to do that has been praised in any way. It has been my life, and through it I have tried to touch each and ·every one of you in some special way. I had hoped, through my written words, to bridge the gap between us; instead, I have only made it wider. To those I may have hurt or offended, I am deepl,Y sorry. CLASS ADS Fast accurate typing? Ask for Jennie (545- 3465) Need a job'' Drop by the Student Employment Center located in Garinger Hall . Room 239. We have new listings coming from employers throughout Charlotte. Death Row Prisoner. Caucasian male, age 35, desires correspondence with male or female college st udents . Wants to form some kind of friendly relationship and exchange ideas. Will answer all letters and exchange pictures. If interested. write to: Jim Jeffers. Box B-38604, Florence. Arizona 85232. Found: calculator-for information call 552-1265 For Sale: I. Sears Exercycle- good condition , new bar 30.002.WomensClothes(winter)sizes81012.juniorsizestoo.Veryreasonableunder30.00 2. Women's Clothes (winter)- sizes 8-10-12. junior sizes too. Very reasonable- under 10.00 each 3. Children's clothes - Boys size 4/ Girls size 6 Contact E.J. McGee, 535-5560 after 6 p.m. Share duplex- 3 bedroom, 2 bath; one room­mate needed- female . Stop by TH 102

    The Spark, Volume 5, No. 5

    No full text
    Thel11ark CENTRAL PIEDMONT COMMUNITY COLLEGE Taylor Hall 102 Charlotte, North Carolina Volume 5 Number 5 Friday, December 12, 1980 (704) 373-6751, 373-6665 (/) 1J fT1 0 )> r rrt C -I 0 z Traffic solution proposed by Planning Commission The Charlotte-Mecklenburg County Planning Commission is developing a proposal that may solve Elizabeth Avenue's dangerous traffic situation. The idea calls for the downgrading of Elizabeth to a boulevard with three lanes separated by an approximately twelve-foot-wide median. According to Fred Bryant, Assistant Director of the Planning Comission, "very pre­liminary" staff work is being carried out. Although no formal plans have been drawn up, planners feel that the idea is implicated in the Central Area Planning Analysis performed by RTKL, a Boston consulting firm hired to reshape the face of downtown Charlotte. Two lanes, under the proposal, would handle outbound traffic from the downtown area, while one lane would carry inbound traffic. The inbound lane would have a bus lane at selected oints alon Elizabeth to allow-traffic · o pass~ 1 he median could accommodate pedestrians who often jaywalk along Elizabeth, dodging a large volume of traffic. A student was struck by an auto­mobile on Elizabeth Avenue Novem­ber 24 near the intersection of Old Kings Drive. Marisa Silvia Garcia, of 2512 Finchley Drive in Charlotte, sustained leg injuries when she stepped off the curb into the path of an oncoming vehicle after leaving the Central Forum cafeteria. The driver was not cited, police told the Spark. -- area." Planners are now faced with the problem of making Elizabeth safer for students, many of whom jaywalk rather than use street-level crosswalks at the intersections of Elizabeth Avenue at Kings Drive, Old Kings Drive, and Independence Boulevard. Officials want to try "providing places to cross where the demand is, which is the whole length of Elizabeth Avenue ," said Steve Griffin, the principal planner for community development. He stated that the RTKL plan, which ends at the Independence Expressway, implies a new configura­tion for Elizabeth. The Expressway, slated for completion next summer, links E. Fourth Street with Independence Boulevard at Kenilworth Avenue, and is expected to stem the flow of traffic onto Elizabeth Avenue. Br ant said that the lan, if im­plemented, "would not make through access ( on Elizabeth) as attractive" to motorists entering and leaving down­town area during rush hours. CPCC President Richard H. Hagemeyer told the Spark that the proposed solution to the traffic dilemma on Elizabeth was "far superior to the overpass, but the median is not the perfect soultion." He called the idea "an acceptable solution" and "a tremendous relief for the students using Elizabeth Avenue." A special college bond referendum, passed overwhelmingly in November 1978, provided funds for the con­Sparkphoto/ Gloria Kilgo Asked to comment on the con­tinuing danger to students crossing Elizabeth, Hagemeyer stated, "One accident is too many, but accidents are happening with greater frequency (on Elizabeth). Some solution has to be found. Hopefully, slowed traffic flow will be the best solution." struction of the Elizabeth Avenue parking deck and a pedestrian overpass connecting the parking deck with classroom buildings across the street. The county later requested that the pedestrian overpass not be constructed, saying that it would "have less safety rationale in the future than it does now, and, in addition, would probably be counter productive to the opportunities that are in the process of coming to this Hagemeyer said the proposed plan would have to be handled by several state and local agencies, including the city and county governments and the N. C. State Depart­ment of Transportation. Nat'/ Players in Shakespeare's The Tempest by Karen Helms On January 16, 1981, the Student Association's Concert/Lecture Board will present William Shakes­peare's The Tempest at 8 p.m. in Pease Auditorium. The classic play will run as a "one-night stand" with a $4.50 admission. This will be the first presentat­ion of the newly-formed Concert/Lecture Board. The group plans to bring a broad range of future entertainments to campus. The Tempest is one of Shakespeare's strangest and most colorful plays. The Oxford Companion to English Literat­ure calls it "a romantic drama." The play actually blends an intriguing mixture of love, magic, comedy, and terror. It even features a horrible monster. Begun in 1611 and finally completed in 1623, it is the last of Shakespeare's completed works. It is a play full of enchantment. Prospero, deposed Duke of Milan, is shipwrecked on an uncharted island. His young daughter, Miranda, is his only companion. He and the child do not know the island is the banishment-place of Sycorax, a wicked witch. Sycorax,longdead,hasleft her son Caliban as the sole inhabitant of the island. Caliban, a mis-shapen monster, is under the magical spell his mother had cast over the entire island. Fortunately, Prospero has extensive knowledge of magic and magical powers. Survival depends on this and his cunning. They do survive, and after twelve years another band of castaways lands on the island. Among this group is Ferdinand, son of the King of Naples. He and Miranda, now a lovely young woman, fall in love. After many bizarre, comic, and terrifying twists in the plot, Ferdinand, Miranda, and Prospero sail away from the island. Their ship has been magically restored. The sad, lonely monster Caliban is once again left as the sole inhabitant of the magic island. The Tempest will be performed by the National Players, a touring company in its 32nd season. Their rendition of the Shakespeare classic now includes a compelling new musical score. Showtime is 8 p.m. on January 16, 1981. For res­ervations or information, call 373-6512. Tickets may also be purchased at the box office at Pease Auditorium. During Winter Quarter the Drama Department plans to present The Crudble. This Arthur Miller classic is set during the New England witch-hunt period of early America. Miller wrote the play as a protest against the blacklistings and "Red Scare" of the '50s and the McCarthy era. The playwright himself had been accused of communist sympathizing and blacklisted. The Crudble has become a modern classic of American drama. The Wedensday Recital Series continues next quarter in the Music Hall. Call Mary Lou Paschal at 373-6757 for more information. by Jimmy Brock A community college campus might seem an un­likely place to find a political lobby organization. Central Piedmont Community College has one-and it's thriving. Support Our Community College, Inc. (SOCC) is a campus political action group which "to encompass all friends of CPCC." Stu­dents, staff members, faculty, and alumni are eligible for membership. SOCC states four main goals-the welfare of students, dissemination of information on issues affecting community colleges, encouragement of its members' acceptance of leadership in civic affairs, and to give its members a common voice in addressing matters affecting CPCC. Implementa­tion of these goals includes reviewing of national, state, and local political candidates' qualifications. Promotion of voter registration, candidate forums, and personal lobbying also figure prominently in SOCC plans. According to John Cozean, SOCC president, the group has about 230 members, thirty of them students. Its fifteen-member board of directors includes Vice-President Cary Hawthorne, Secretary Patricia Treadway, and Treasurer Willie Artis. No officers are students, and board member Lynn Bonavita is the group's only official student representative, according to Cozean. Cozean says SOCC actively seeks student membership. "Several times over a three-month period- in late 1979 , when we were formulating by-laws- I contacted (SPARK editoL)-lo.e__S_o.vacnol,-=c{f ormer- N4£SGLprnsiden t) Alan Sizemore, and even (Student Activities Director) Ross Surphlis," he said. "We tried to enlist their aid in building student involvement in SOCC. I've contacted these same people several times since then. Their response so far has been negligible ," Cozean added. Regarding this, Joe Sovacool said, "The Spark pub­lished announcements of SOCC's activities in the Calendar of Events for the Special Edition of Volume 5, no. 1, which enjoyed a distribution of over 21,000 ." Sovacool added that "as a student publication, the Spark does not officially align itself with any organization, with the exception of the Student Publications Agency Advisory Board and any Support Our Community College, Inc. national organizations which concern themselves with student journalism." Alan Sizemore said, "The best way to reach students is to go to PAC and club meetings and talk with the students in them. Maybe there is no student interest in SOCC­maybe he (Cozean) should face that possibility .. . SOCC was first mentioned to me in a meeting with Joe Sovacool, Dr. (Richard) Hagemeyer, and Jack Cozean. It came up as a sideline to the topic under discussion . My next contact with SOCC was after SOCC had chosen its name and its by-laws had been written." Student Activities Director Ross Surphlis declined comment. SOCC recently sponsored campus voter registration drives, candidate forums, and a "get-out-the-vote" drive the day of the Presidential election. Cozean attributes poor student turnout to failure of student leadership. "I'm not __ sur_e_thg student1ead_ers...:trie_d_a8-Ill.Uch a& they could have to help drum up student interest and support," he said. Cozean does cite (Student Senate Chairwoman) Beverly Haigler and (COC Chairwoman ) Lynn Bonavita as being "very helpful and supportive." Haigler invited Cozean to a full Student Senate meeting to present SOCC's case. SOCC has some image problems. Many see the group as a faculty/staff oriented organization. Cozean, a former· lobbyist for the Missouri State Teachers Association, is trying to correct this. He seems concerned with credi­bility among students. "We are a broad-based group working for the welfare ofCPCC as a whole . We want active student membership- but we really need support and help from the student leadership on our campus," he said. "Students will respond better to those of their peers who are campus leaders," Cozean added. Candidates face off for an SOCC political forum Sparkphoto/Chapie Chapman Lynn Bonavita admits SOCC "does have some problems in identifying with students. The only reason they (SOCC) have the problem of identifi­cation with the students is that stu­dents do not realize that the organiza­tion is open to them also." Beverly Haigler said she had invited Cozean to a Student Senate meeting as a pos­sible way of reaching out to students. Problems of communication between SOCC and campus student leadership seem to still exist, but do not appear insurmountable. Artist in Residence Tom Brad/ ord The pen is mightier . • • "unsophisticated." he felt-tip pen is something most of us take for granted. Not Tom Bradford. His felt-tips have taken a while to gain acceptance in the world of fine visual arts , and he says there was a time when they were considered But with 246 pens, each with either a different color ink or varying nib sizes, the possibilities seem endless. Bradford is the new Artist-in-Residence here on campus. North Carolina is the only state in the nation with a visiting artists program for community colleges and technical institutes, and more than fifty of these schools participate in the program. The Artist-in -Residence program here rotates between the humanities, performing arts, and visual arts depart­ments. He was brought here by Art Department head Tim Freeman through the North Carolina Arts Council. But "It's not like being in the military," Bradford says. Graduating in 1971 from the University of Alabama, or as he calls it, Bear Bryant country, where " they had the art department in the end zone," he took his major in painting and min"or in printmaking to New York for a year and a half, and with the exception of a month's work as a carpenter's helper, survived from the sale of his works. He spent two years in the Artists-in-Schools program in Alabama, and hopes to try for it here in N. C. While the artists-in-residence are based at community colleges and technical institutes, the artists-in-schools operate out of elementary and secondary schools. Bradford donated one of his works for the Interior Design Club's art sale and exhibit on Harvest Day, October Tom Bradford at work in his studio photo courtesy Media Prodw:tions 22. He speaks and holds workshops in classrooms on campus, and visits public schools. Freeman says it's hope­ful Bradford will hold an exhibit of his work on campus during Winter Quarter. He's also available to school and civic groups for slide shows, research, and workshops. Call Donna Ward at 373-6430. nfluenced by the surrealists such as Jackson Pollack, Bradford's work shows a rather delib­erate playfulness, full of the bright colors of his pen set. He's been using colored pencils for accent, and solvents to break down the ink from his pens after it's been applied. He's currently working on a series portraying twenty­six "can-smashings" of different variations and even rareities, such as "the protruding tab-top" and "the full-circle stomp." This series he intends to exhibit at the Deacon Galleries on Cassell Street in Wilmington , March 1981. Bradford sees his role as Artist-in-Residence as that of "a liason between the general public and the art public." "I want to make an art that's more universal in scope," he says. He was influenced heavily by the old Zap Comix artists such as R. Crumb, and he finds that while twentieth century art is the most exciting period for him, it's often deemed unacceptable, "because it's all theory ." About CPCC, he says, "I've been told it's the best two-year art school in the state." His new brochure was designed by sixth-quarter student Kim Yost of Salisbury. Bradford's presence at CPCC should prove entertaining for students both on and off campus. by Cindi M. Skridulis "Auto Tuneup" (AUT 5203) is offered frequently at Central Piedmont. I talked with Loretta Pearson, a student in Mark Fun­derburk's Saturday morning class to find out about it. The Spark: What did you expect to get out of the class? Pearson: The main thing I expect­ed was to have more knowledge of what's going on under the hood of my car. When something goes wrong with my car that I can't fix, I want to be able to take it in and say, "Hey, my timing's off." I don't want to walk in and just say, "There's something wrong with my car." Some places can really cheat you. The Spark: Who's in the class? What kind of people are taking it? Pearson: There are about twenty of us in the class. Five women, the rest men. When we statrted, some of us knew nothing about cars. Most of the men had a basic knowledge. They came to fine tune what they do know. They've been awful helpful to the la- - dies.- The Spark: Do you need your own equipment? Pearson: Yes. During the first class, you are given a list of basic tools to buy. These include screwdrivers,sock­ets and nut drivers, ratchets, pliers, wrenches, and a feeler gague to start with. Many of these you'll already have at home. The Spark: How is the class taught? Pearson: So far we've use.d films and charts in the classroom. There's some memorizing of basic parts under the hood. The instructor usually gives an hour lecture. He goes through ev­erything in class, then we go straight to the lab and apply what we've learned. The Spark: Sounds like a good way to learn. Pearson: It is. I can sit in class all day but unless I really do it, I forget. The Spark: Do you work on your own cars? Pearson: Yes. Everyone's car is different and if you didn't learn to apply what you learn to your own (I've got a '77 Mercury Monarch) the class wouldn't help you much. There's room for about four or five cars in the shop Auto Tuneup offered ~ and if the weather's nice, you can w0r - 0utsid~- We tak-€- tums-pullin-g our cars in and helping eachother. There are usually three or four of us working on each car. The Spark: Doesn't it make you nervous to work on your own car? Has anything ever gone wrong? Pearson: Sure I get nervous. When - W€ - adjusfo<f something on my car, there was a vacuum release valve on the distributor that you're supposed to un­plug when setting the timing. We for­got to do that, and after class I got to Independence Boulevard and it quit cYn me. You learn from your mistakes. Sparkphotos/Gloria Kilgo The library was closed while staffers shuffled books Sparkphotos/Chapie Chapman Testing Center relocates to 4th Floor of LRC More than 61,000 books housed on the fourth floor of the Hagemeyer Learning Resources Center (LRC) were moved last month to make room for a new testing center slated for completion in January. The fourth floor was closed to the public from Monday, November 10 til Friday, November 14. Right in the middle of term paper time, students needing research materials had to stop at the third floor and ask for them. The LRC staff then sent runners upstairs to fetch the books. All ranges of the collection had to be moved in sequence, and no library services were available after 5 pm. The fourth floor was expected to be closed through the Thanks­giving holidays, but reopened at noon November 14. Signs notifying students that the fourth floor was closed were posted at the second floor elevator landing, but no­where else on campus. Director of Library Services Phoebe Oplinger told the Spark that a little more than a third of the fourth floor seating space such as lounge chairs, study carrells, and oversized tables will be lost in order to make room for the new testing center. Some seating will be moved to the mezzanine of the LRC. "We have not closed the library, contrary to some of the complaints received from students," Oplinger said Novem­ber 14. Asked if the shuffle may have hindered students from using the fourth floor facilities and finding books there, Oplinger stated, "The hindrance has been that they (students) could not browse." Oplinger stated November 17 that it took library staff "a little longer to locate materials during the actual moving." Designed to replace the old testing areas on tlj.e fifth floor of the Terrell Administration Building, the new testing center will provide 4,600 square feet of space for placement testing, as well as regular lab and course testing, which weren't being held in the old testing areas. The fifth floor Terrell has 2 ,200 square feet available for regular placement testing. Director of Veterans Affairs John Tripp will oversee the new center which he described as still "in development." He said November 24 that he has requests from several departments interested in using the new center for class testing. The college originally wanted to put the new center on the mezzanine of the LRC, where the reference collection is currently kept, but found security to be better on the fourth floor. The lack of restrooms on the mezzanine also presented a problem, said Tripp, who added that noise caused by students using the third floor facilities was a concern in operating the new testing center. Do inmates get an education? by Cindi M. Skridulis guard ... It doesn't make much sense. Few Spark : My source seems to feel that prisoners at the Camp Greene and the prison officials purposely tried to Huntersville units have a high hinder the program. school education. Some even lack Brown: That's totally wrong. It's a misstatement of fact. There's no way basic reading and writing skills. in the world we'd sponsor a program So why have no Adult Basic Ed- and not totally support it. ucation classes been held at these Spark: Are prisoners getting any basic institutionsin the past three years? educational training at this time? Ernest Stanback, Director of the A- Brown: There are a couple on on-un-dult High School Completion Program it programs basically covering the same here, had his own ideas on the matter. thing: pre-release training, community Was it a lack of interest on the part of readiness training and tutoring by vol-the prisoners? "It's a funny situation unteers . .. .it's because of the uneducated guards Spark: Do you plan to request an that can't stand blacks being more ed- ABE class in the furure? ucated than them." Brown: If we find a need for it and The last Adult Basic Education (ABE) have the space. class was about three years ago. Stan- Spark: Would you say that most of back talks about broken promises: your inmates do not have a good basic "Raleigh talks like they want to do education? something. The prisons promise to let Brown: Most have not completed men come to class, then don't send high school. them as punishment;. They say the Spark: Why do you feel there hasn't classes are always open ... The super- been much inmate interest in the ABE intendent's word doesn't mean any- program? thing. He makes rules and when he Brown: You have to recognize that leaves, they (the local prison manage- these men may be taking part in work __ment) changeandmaketheir owmules" __ releas.e.,_ p_r.e-release, or e-lease Stanback says that shortly after a (where they go home Friday afternoon class began, you could find the instruct- till Sunday afternoon). A lot of them or sitting alone under a tree with no are too tired to be interested in an ed-students to teach. "They change the ucational program like this. We're try-rules of the game to keep people from ing as near as possible to educate these learning," he says in frustration. people along with our r~sponsibilities to With Stan back's information, I called the community. J. A. Brown, program supervisor at After talking with Brown, I got in

    The Spark, Volume 10, No. 1

    No full text
    February 1, 1984 Volume 10, No. 1 Taylor Hall 102 P.O. Box 35009 Charlotte, N.C .. 28235 CENTRAL PIEDMONT COMMUNITY COLLEGE 'Photo by Betsy Bowen LET IT SNOW!!!! When the weather report predicts snow, ice, or other weather causing hazardous driving conditions or you wake up to an unpredicted blanket of white, the big question is whether classes will be held. The CPCC administration states that in case of inclement weather, listen to Charlotte radio stations. Stations are notified before 6:30 a.m. if classes will be cancelled. Do not call radio stations or college administrators. DORSEY APPOINTED SPARK EDITOR "There's no such thing as luck," says Michele Dorsey, new editor of The Spark. "In everything there is effort and from this effort comes results." With this issue of The Spark, Dorsey is dividing her time and ef­fort between taking 14 hours of classes and publishing five issues of The Spark during the winter quarter. She joined The Spark staff as assignment editor last fall soon after registering in CPCC's college trans­fer program. Born in Charlotte , Dorsey lived in Baltimore, Maryland, until about two years ago. At Olympic High School, she won a contest that gave her the honor of delivering a speech for the class of '83 on her graduation day. Recently she was appointed to the board for the Counsel on Ado­lescent Pregnancy, and is an active member of the Afro-American Cul­tural Club. She was featured as the "Beauty of the Week" in the Jan. 5 issue of The Charlotte Post. Dorsey plans to transfer to Howard University or UNCC to ... ,~ work toward a B.A. in communica-tions, and then enter broadcast journalism. Her hobbies are photo­graphy and writing poetry. Dorsey's philosophy includes the feeling: "I like to see people come together and look at one an­other for what's inside the person , not just for what shows on the sur­face. LIBRARY HAS BIOGRAPHY ON LENA HORNE light of her enormous success and acceptance everywhere in the music world. She spent time listening to her jazz collection in which clarinetists Sidney Bechet and Edward Hall were prominent, and she read murder mysteries for relaxation and bio­graphies for instruction. Her non­singing voice has become more and more that of the activist, not just as a Black woman but as a serious, con­cerned, very strong-minded lady. by Mary Moose.acquisitions manager "Popular" and "Best Seller" catego­ries of books are provided by the Library for students and staff, in­cluding a variety of both fiction and non-fiction, as well as both light and serious reading. These books, "The McNaugh­ton Collection," are located in the REFERENCE area, near the news­papers, on the third floor of the LRC. Easy-access to this type of reading is provided by the Library both for the convenience of its stu­dents and staff and for the encour­agement of the use of all the Library facitlities. About 20 new titles are received each month, 20 older titles being returned. Newly added is LENA, the bi­ography of one of the best known, and not incidentally , the most beau­tiful women in the world. Lena Horne's life is chronicled from her birth in Brooklyn, in 191 7, child of STAFF Editor . . . . . . . . . . . . . . .Michele Dorsey REPORTERS Richard Garcia Genise Williamson Michael Kelley Sharon Walker Arlene Weston Peggy Ann Lumpkin Billy Spann Betsy Walker Thomas Morgan Kimberly Lowry PHOTOGRAPHERS Georgia Lewis Denise Williamson Orema Alexander TYPSETTER Sandra Hill Advisor of Student Publications .... ... .. . . . . . . . . . . . . . . . . . . . . . . Mary Flock Director of Student Activities. . . . . . .... . . . . . . . . . . . . . . . . . . .. Ross Surphlis POLICY The contents of The Spark may not be reproduced without permission of the edi­tor. The Spark is a student publication fi­nanced by student activity fees, written, edited and published by student journa­lists for the CPCC community. It is not an official college publication, and any viewpoints expressed herein should not be interpreted as represeting official CPCC positions. 2 a successful numbers banker and a not very successful actress with a black theater troupe. The co-authors trace her rise from the famous Cot­ton Club through her unprecedented singing career with an all-white band, marriage to white musician Lennie Hayton, and her friendship with Paul Robeson and subsequent black­listing. Lena Horne's extraordinary beauty overshadowed her talent in some ways, and the indignities she suffered from being Black, female, and beautiful were particularly ig­nominious and frustrating in the She has observed that even her concern over mixed marriages and relationships seemed not to apply in cases where the couples had enough money ... same for white couples. "I think if both members of the wed­ding have a job, then it's okay, but cont'd to p.4 What Happened To Your New Quarter Resolutions? by Michele Dorsey While everyone was shouting out New Year's resolutions, I am quite certain that CPCC students were also shouting out New Quarter reso­lutions! "I will not oversleep and miss my 8: 00 class, when my friend wants to go to the Double Doors, he will walk ALONE, and I will not spend my book money on anything other than books. The making of resolutions is typical of everyone who sees a chance to start anew. Most of America makes their New Year's resolutions at a New Year's party while they are intoxicated and "firm determination" comes easy. Thier "befuddled" state ends by the time January has a chance to really announce itself and out go the wonderful, but idle promises that they made. Nine times out to ten they will begin next year with the same soon abandoned resolutions. But as college students we don't have to remain failures until next year. We have four times a year to reinforce out New Quarter resolu­tions; winter, spring, fall, and summer quarters. Yes, four times a year we are reminded that we are either neglecting our responsibilities to ourselves or doing a fine job in fulfilling them. If we are neglecting our student resolutions we have ample time to get back on our intended path. Oh boy, isn't it so much easier to make college student resolutions and keep them, than to promise to diet, exercise, and remain happy through it all?! Anyway, Happy New Quarter!!!! We Want To Hear From You There's space in The Spark for your opinions, suggestions, and ideas. We invite your comments on what you read in these pages. We invite your constructive criticism when you witness something on campus going awry. We invite your compliments about what goes well. Not all letters will be printed on these pages and we doubt that we'll use any not signed by the author. Letters to the editor should be sent interoffice to Taylor Hall 102 or through U.S . mail to The Spark, CPCC, P.O. Box 35009, Charlotte, NC 28235. AACE-C PRESENTS BLACK HERITAGE \NEEK Kelly M. Ale x ander ,Jr. The Afro-American Cultural and Educational Club will sponsor BLACK HERITAGE WEEK Feb. 6- 10. Designated as Black Heritage Week three years ago by Dr. R. H. Hagemeyer, this week has become a tradition eagerly awaited by many on the campus. Scllecl•le of Eve11ts Wed., Feb . 7, 6:30p .m. - Pease Con­ference Room DEBATE: "Blacks have not made progress in the last 20 years." Roberta Greene - Moderator Marvin Krieger - Pro speaker Bertha Maxwell - Con speaker FREE FEBRUARY 6- 10 Thurs., Feb. 8, 12 noon - 2p.m., Taylor Hall (Gym) Afro-American Day/AFRAM DAY Activities: African Fashion Show African Cuisine, Art, Poetry Reading Special Guests: Sisters of Support FREE Fri., Feb. 9, 12 noon , Pease Audi­torium NAACP DAY Speaker: Kelly M. Alexander, Jr., president of the Mecklenburg County branch NAACP, Membership Drive for NAACP & AACE-C FREE Sat., Feb. 10, 8p.m. - Taylor Hall (Gym) AFRO-AMERICAN CULTURAL NIGHT Activities: Reggae music by Aware­ness Arts Ensemble CPCC student dance group Jed by Rickey Hood Gospel music by the John Kee Singers Master of Ceremonies - Duane Barron, chmn. of AAEC-C Tickets: 3w/studentID.3 w/student ID. 5 w/out student ID. On sale Student Activi­ties, Taylor Hall 102. FOCUS ON YOU Through funding from Vocational Education, provided by the Special Services Department at CPCC, the Women's Career Center will co-spon­sor with WomanReach a series of free personal and career development courses during the winter and spring of 1984, entitled "Focus on You." To be eligible to attend, a wo­man must be experiencing circum­stances in her life which necessitate change-change such as returning to school, going into the workforce , changing jobs in order to support her responsibilities or become more fulfilled. The facilitator is Lenora Jones­Deutsch, who has her master's de­gree in Clinical Psychology, is in private practice in Charlotte as a therapist/ consultant. Advance registration is required in order to process Career Inventory prior to the beginning of each course. Participation is limited to 20 partic­ipants. Dates and times for the three two-week sessions are: Morning session: Feb. 6-10, and 13-17, 9 a.m.-1 p.m. Morning session : March 5-9, and 12-16, 9 a.m.-1 p.m. Evening session: April 9-13, and 16-20, 6-10 p.m. For a brouchure, call 373-6644, 9-5 weekdays. To register call a peer­counselor at WomanReach, 10-4 weekdays, at 334-3614. If clas s you skip, your grade will slip ! ! Students wit~ the highest grade point average skip the fewest classes. This fact emerged from a research project by a journalism class at Memphis State University. Students in newswriting classes completed 259 informal interviews with stu­dents in lobbies, restaurants, and parking lots. The results show that students don't just "miss" classes; they skip classes. And by and large, they don't mind talking about it, citing the most frequent reasons for skipping as they "just don't feel like going," classes are boring, or they overslept. Other findings from the survey include: Younger students and those early in their academic career miss the most classes. The more likely students are to attend class, the more likely they are to resent others who do not attend. Dormitory students are just as like­ly to miss class as those living off campus. Students who pay all their fees them­selves are only slightly more likely to skip fewer classes. 3 Architectural Civil · Engineering Society At ACES' first meeting of the winter quarter, held January I 8 outstanding scholars were presented with certificates re­cognizing thier achievement of a 3.75 or better grade point average for fall quarter. Those receiving certificates were: Nikki Buchanan, Billy Burgess, Bruce Craig, Scott Gregory, and Kevin Williams. • • • • • • Afro-American Cultural and Educa­tional Club. The AACE-C is proud to an­nounce CPCC's first Black His­tory essay contest during the month of February. All stu­dents may enter this contest. The essay should be at least 300 words and should not ex­ceed 500. The essay may deal with any facet of Black History . The deadline is February 29. Papers are to be turned in to Grace Atkinson, Van Every Building Room 231. The winners of this contest will receive: 1st : 2 seasonal tickets to CPCC Theatre. 2 lunch reservations to the Food Service Dining Room. 2 dinner reservations to the Food Service Dining Room. 2nd : 2 lunch reservations to the Food Service Dining Room. 2 dinner reservations to the Food Service Dining Room. 3rd : 2 lunch reservations to the Food Service Dining Room. •••••• The Topcat Club 4 The Topcat Club received spe­cial recognition for outstanding community service concerning their participation in the Duke Power Community Weatheri­zation Program. This program is designed to help people re­ceive weatherization benefits and service to keep electric bills from sky rocketing and protect them from the cold. • • • • • • Galley VI Want to see yourworkpublish­ed? CPCC's magazine of liter­ary and visual arts is now ac­cepting submissions. To get a copy of guidelines for submit­ting material contact Student Activities Office, Taylor Hall 102, or phone 373-6665 . Dead­line is February 29. Cash awards! ! • • • • • • United Campus Ministry The UCM sponsors an inter­faith discussion of faith and values co-ordinated by all of the ministers. They will model the program to fit the needs of the group. The group will meet every Thursday at 12:00 in the Van Every Building Room 109. • • • • • • Baptist Student Union The BSU will have their bible study every Wednesday at 12:00 to 12:50 in Van Every in Room 109. Catholic Student Group The CSG will have their bible study every Tuesday at 12 :00 to 1:00 in Van Every in Room 109. • • • • • • GED-High School Completion Stu­dents If you are enrolled for GED or High School Completion and between the ages of 16-21, The Charlotte Mecklenburg Youth Council and The City of Charlotte Employment and Training Depart. is sponsoring The Education for Employ~ ment and Limited Work Expe­rience Program. They will offer part-time work, pre-employ­ment training/counseling, and job development. • • • • • • The Forum Maggie Ree will perform in the Forum on Feb. 10 at 12:00. Maggie Ree (•Lena Horne" cont'd from p.2) money is going to keep us fighting ... and we blame it on race." Miss Horne is not an enormous­ly wealthy entertainer, and her main concerns are that making money be­comes more and more important than principles, and that the effect on young people is crucial. Other recent books are NUREYEV, by C. Barnes .. .THE STORY OF HENRI TOD, by Wm. F. Buckley, and THE NAME OF THE ROSE, by Umberto Eco

    The Spark, Volume 45, No. 7

    No full text
    The College's graduation ceremony takes place on May 25, where approximately 400 out of 1,012 potential graduates will receive diplomas. Central Piemont changes from their quater system to a new semester system in 1997. Central Piedmont's 35millionbondforthecampusexpansionisdiscussed.Astudenttalksaboutthegoodthatllcomefromthebondandhowitllhelpwithparkingandrepairsalongsidebuildingnewcampuses.AstudentleavesanoteonthedooroftheStudentPublicationsOffice,drawingattentiontotheerrorsbeingmadeinTheSpark,whichledthemtopostanadvertisementaskingforeditors.Asurveywastakenandtheyfound21NEWSBRIEFSKeystone95deadlineThedeadlineforsubmittingworktoKeystone95isMay19.Submityourpoetry,prose,artorphotographytoCPCCsstudentcreativeartsmagazine.Forinformation:LizRogers,StudentPublications,Taylor205,3426665.SGAelectionresultsTheStudentGovernmentAssociationelectednewofficersonMay12.Theemergingstudentleadersareasfollows:PresidentMichaelSpomerVicePresidentAdamRosenbergerSecretaryTanikaKimbroughPublicInformationOfficerSteveHagarTreasurerErinCrouseParliamentarianSuzanneRallisJobExpocomingKnowsomebodywhoneedsanewopportunity?Hotelandrestaurantemployeesareofferingculinarytrainingleadingtojobsstartingat35 million bond for the campus expansion is discussed. A student talks about the good that'll come from the bond and how it'll help with parking and repairs alongside building new campuses. A student leaves a note on the door of the Student Publication's Office, drawing attention to the errors being made in The Spark, which led them to post an advertisement asking for editors. A survey was taken and they found 21% of students sleep in the library. Student Life honors the oustanding members from the different student organizations. Phi Theta Kappa (PTK) holds its first bake sale. Central Piedmont's creative arts magazine, Keystone, is looking for works of art to be judged for the year's issue. Hands On Charlotte offers a scholarship to 40 students who serve as teacher helpers. 30 Central Piedmont students tour the United States capital. The Summer Theatre opens soon. Dance Central has a night of choreography. Central Piedmont has its third annual Spring Literary Festival. Central Piedmont holds an International Springfest. The League for Innovation in the Community College hosted its annual literary competition for students in community colleges across the country, and Central Piedmont student Gloria Schenck wins first place nationally in the category of personal essay. A Keystone contributor wins a national award. Central Piedmont's Crimebeat talks about the recent incidents from the security log. A Central Piedmont student wins the American Association for Women in Community Colleges (AAWCC) scholarship. A cash box goes missing in the Student Life Center (SLC). Dr. David Hunter was honored for years of service. The Student Government Association's fundraiser fell short, with them only making 10% of their goal.Volume 45 Number 7 NEWS BRIEFS Keystone '95 deadline The deadline for submitting work to Keystone '95 is May 19. Submit your poetry, prose, art or photography to CPCC's studentcreativearts magazine. For information: Liz Rogers, Student Publications, Taylor 205, 342-6665. SGA election results The Student Government Association elected new officers on May 12. The emerging student leaders are as follows: President- Michael Spomer Vice President- Adam Rosenberger Secretary- Tanika Kimbrough Public Information Officer- Steve Hagar Treasurer- Erin Crouse Parliamentarian- Suzanne Rallis Job Expo coming Know somebody who needs a new opportunity? Hotel and restaurant employees are offering culinary training leading to jobs starting at6.ti0 an hour. Employers will be at "Job Expo" on May 23 at 9 a.m. in the Citizens Building. Those selected will receive four weeks of training and supplies paid for by area employers. Applicants need to be 18 years old and haveatenthgradeEnglishproficiency. A high school diploma is not required. All interested MUST sign up in Terrell231 (before4p.m.)byMay 19. Graduates of this training program will receive a Food Service Specialist certificate. This program is offered in conjunction with CPCC's hospitalii.y program and the NC Department of Labor. Sponsors include the Charlotte Mecklenburg Restaurant Association and the Greater Charlotte Hospitality & Tourism Alliance. For more information, call 342-6551 or 342- 5476. MAY 1995 Summer facilities hours pg. 12 Student awards pgs. 8-9 # Crimebeat pg.10 Graduates will march on May 25 by Jennifer Barringer, Staff Writer This year's graduation day ceremony will be held at the Independence Arena on Thursday, May 25, at 7 p.m., with a reception following. There is a total of 1,012 potential CPCC graduates, from summer 1994 to spring 1995, of whom approximately 400 will receive their diplomas at the ceremony. The diplomas will be presented by Dr. Tony Zeiss, CPCC president, and Dr. Alice Villadsen, vice president for instruction. System, will be this year' skeynote speaker. Most recently, Hackley was Chancellor and tenured Professor of Political Science Universities, a position to which he was appointed by President Clinton in November 1993. He was awarded the Bronze Star for " Meritorious Service in Combat with Valor and received his doctorate in political science from UNC­Chapel Hill. The Rev. Sheldon R. Shipman will give the invocation and benediction. Welcomes will be delivered by William Disher, chairman of the Board of Trustees, and Bruce Rallis, president of the In addition to the awarding of degrees, diplomas and certificates, there will be the presentation of the RichardH. Hagemeyer Educational Advancement Award. This award is given to a selected alumnus of CPCC who has brought honor to both him/herself and to the college through his/her achievements. Graduates enjoy recognition at 1994 ceremony. Student Government Dr. Lloyd V. Hackley, president of the North Carolina Community College Photo courtesy of Tom Covington Association. at Fayetteville State University. He is also chairman of the President' sAdvisory Board on Historically Black Colleges and Honor students will be distinguished by sashes. A gold cord will be worn by students with a 4.0 GPA, purple for 3.9-3.7 and white for 3.5-3.6. CPCC will convert to semesters in 1997 by John Bradley, Staff Writer It is official: CPCC is converting to a semester system from the present quarter system. The North Carolina State Board of Community Colleges approved a proposal April 21 to convert all 58 community colleges in North Carolina to semesters, making North Carolina one of the last large community college systems to adopt the semester system. First proposed in spring 1992, the proposal had the support of 56 of the 58North Carolina community college presidents. The semester system will not be phased in until fall 1997, using summer 1997 to implement the change, according to Dr. J. Parker Chesson, executive vice president and chief operating officer of the North Carolina System of Community Colleges. Chesson said that the summer is usually used in the transition to be able to tailor courses for students to get the proper credits they need and not lose credits in · the transition. "In all fairness, it is a large projectandalotofworkforthefaculty,"he said. Dr. Tony Zeiss, CPCC president, thinks that the semester system will be much more convenient for both students and faculty, having himself worked with both systems. Students will have to register only two or three times per year instead of the current three or four times. That means once in the fall semester that begins in August and ends before Christmas; once in the other semester, probably called spring semester, starting in January and ending in May; and once for the eight-week summer session. The traditional "spring" registration will be eliminated. Student record keeping will also be simplified, having to be compiled only three times a year instead of the present four. Zeiss said that the change will require an effort by the faculty and course schedulers, but said that it will be more efficient for the students and the college as a whole. He said that the semester system will be more "cohesive," mirroring the UNC Charlotte schedule. Zeiss said that the semester system will have no adverse effect on the quality of instruction and that it should actually improve with the extra time to cover the subject matter. He said the insttμctors at CPCC really care about what they teach. _ "No fundamental changes are expected" that would result in layoffs either in instruction or records personnel are being anticipated as a result of the change, Zeiss said. He said other community college systems leveled off their staff size after making the change. The length of the semesters at CPCC is yettobedetermined. Theproposalapproved bytheNorthCarolinaBoard of Community Colleges changed the credit hours for community colleges from quarter hours to semester hours and left it to each college to set its own schedule. Semesters will be 15 or 16 weeks long instead of the current 11- to 12- week quarters. Zeiss said that summer session will last about eight weeks as would some courses during regular semesters, pennitting more flexibilityforcourses.Hesaidsomecourses may vary in length with credit based on contact hours. A typical three-ho\D' credit course will involve approximately 45 or 48 contacthoursforthe 15 or 16 week semester. The biggest boost for students will be an equitybetweenK-12andCPCCschedules. see semesters, pg. 4 2 OPINION Campus expansion: The 35millionquestionbyMelanieScnbner,EditorOnMay30,MecklenburgCountyvoterswilldecidewhetherornottoallowCentralPiedmontCommunityCollegetobranchoutfurtherintothecornrnunity.Voterswill,ineffect,decidethefutureofCPCCbyagreeingwhethezornottoprovide35 million question by Melanie Scnbner, Editor On May 30, Mecklenburg County voters will decide whether or not to allow Central Piedmont Community College to branch outfurtherintothecornrnunity. Voters will, in effect, decide the future of CPCC by agreeing whethez or not to provide 35 million in funding to build three of four new proposed expansion campuses to be situated around the construction of the outer belt loop. Many of CPCC's students are registezed voters and will aid in this countywide decision. It is important as both students andcitiz.ens that this decision be an educated one. On May 4, the editors of The Spark were invited to attend a meeting between swdent leaders and the administration in which college president Tony Zeiss discussed the campus need to provide adequate instruction to all of CPCC's students, cwrent as well as fuwre. 1be.following is a list of some of the issues surrounding the bond referendum according to the administration, as I understand them: - The bond issue included on the May 30 ballot is the first of two bond referenda proposed to aid in the expansion of the college. The second bond will come before Mecklenburg County voters as the need arises. Togethez, the two bonds will total 49million.Themaincampusiscurrently166percentbeyondcapacity.Thereisa300,000squarefootshortageofclassroomspace.CPCCisrankednumberoneintermsofspacedeficiencystatewideamongall58communitycolleges.Thenewcampuseswillbeexpandable.EvenbJallyoneofthemcouldbecomelargerthanthemaincampus.Thiscampusis"landlocked."Meaning,thereisverylittleroomtoexpandthemaincampusandmostofthepropeztiescurrentlyavailablearoundtheperimeterofthecampusaretooexpensiveforCPCCtoacquire.Howevez,CPCChasaleasepurchaseagreementwiththeownezoftheToyotadealershiponindependenceBoulevardandplanstoincludethepurchasepriceinasubsequentbondpackage.Over61,000studentsattendedCPCClastyear.Bytheyear2005,thestudentbodyisprojectedtoincreasetoover120,000.Giventhecurrentproblemsplaguingthecampussuchasparkingandwaitinglistsforhighdemandcourses,itseemshighlyunlikelythatthemaincampuscouldaccommodate120,000swdents.Theadditionofexpansioncampusesisexpectedtoreducernaincampusattendanceby25percentEachoftheexpansioncampuseswilloffezspecializeddegreeprogramsandwilleventuallyoffermostifnotallofthenecessarycollege:transfercurricula.CPCCisthenumberonesourceofworkforcedevelopmentintheCarolinas.Thisinstiwtiontrainsandretrainsworkersfromover700localbusinesses.CitizensofMecklenburgandsurroundingcountiesattendedclassesatCPCCtolearnnewtnidesandtoupdateskillstothetuneof61,368enrollmentslastyear,accordingtoCecilCarter,systemsanalystforthePlanningandResearchDepartmentCorporateandContinuingEducationinstructionrepresentedawhopping32percentofthestudentpopulation;highschoolcompletion,GEDandliteracycoursesrepresented11percentoftheinstructionofferedhere;twoyeardegreeprogramsmadeup57percentoftheinstructionwithcollegetransferrepresenting17percentandnontransfer40percent.Nomatterwhatprogrameachstudentonthiscampusisenrolledbi,thechancesarehighlyprobablethatheorshewillreturntocommunitycollegeatsometimeinthefuturetoupdateorerμichhisorhereducation...CPCCistheeducationalsourceforthat77perceniofthepopulationwhichdoesnotgoontouniversitiestoreceiveafouryeardegree,.Mostlikelythis77percentwillbemostaffectedbythecampusexpansion.Ithasthepotentialtoputtheeducationtheyseekclosertotheirhomesandoffices.Thepmposeofthiseditorialisnottopersuadeswdentstovotefororagainstthebondreferendum.Rath«,thepmposeistourgeeachswdentasaregisteredvotertoshowupathisorhervotingprecinctonMay30andcastaninformedvote.Forfurtherinformationconcerningthebondreferendum,pleasecontactthefollowingmembersofTheCPCCBondInformationCommittee:JimSasser,3426615;ErvileenPridgen,3426907;Dr.PhyllisBarber,3425931;orJudithMcGinnis,3426666.IfyoucareaboutthefutureofCentralPiedmontCommunityCollege,ifyoucarehowyourMecklenburgCountytaxdollarsarespent,ifyoucareaboutyourinalienablerightsasanAmericancitizen,doyoucivicduty:VOTE.StudentsupportsCapitalCampaign.,bondDearEditors:MynameisTracieD.TallantandIamcurrentlytheParliamentarianfortheStudentGovernmentAssociation.IhaveattendedCentralPiedmontCommunityCollegeoffandonforoversevenyears.IhaveobtainedmyHighSchoolDiploma,myAssociateinSecretarialScience,andamcurrentlyworkingonmyCollegeTransfezcreditstoattendauniversity.IthasbecomeapparentthatmanyofourstudentsarenoteducatedonsomeoftheissuesthatourCollegefaces.Iworkdiligentlyeac quartertoraiseawarenessonthiscampus.SometimesitisverydiscouragingtohearstudentstalkingaboutCollegeissuestheyknownothingabout.TheStudentGovernmentAssociationmeetseveryweektohelpbringawarenesstoallstudents.OurGeneralAssemblymeetingsareheldthesecondFridayofeachmonth(at12:30p.m.inVanEvery103)andilllswdentsareinvitedtoattend,participate,andgetinvolved.BelowIhaveattemptedtosimplifytwoofthemapeffortstheCollegeisattemptingatthistime.TheCapitalCampaigniscoordinatedbytheCPCCFoundationandareabusinessleaders.Thiscampaignisafundraisingefforttoraiseapproximately49 million. - The main campus is currently 166 percent beyond capacity. Thereisa300,000 square foot shortage of classroom space. CPCC is ranked number one in terms of space deficiency statewide among all 58 community colleges. -- The new campuses will be expandable. EvenbJally one of them could become larger than the main campus. - This campus is "landlocked." Meaning, there is very little room to expand the main campus and mostof thepropezties currently available around the perimeter of the campus are too expensive for CPCC to acquire. -- Howevez, CPCC has a lease-purchase agreement with the ownez of the Toyota dealershiponindependenceBoulevardand plans to include the purchase price in a subsequent bond package. -- Over 61,000 students attended CPCC last year. By the year 2005, the student body is projected to increase to over 120,000. Given the current problems· plaguing the campus such as parking and waiting lists for high-demand courses, it seems highly unlikely that the main campus could accommodate 120,000 swdents. -- The addition of expansion campuses is expectedtoreducernaincampusattendance by 25 percent -- Each of the expansion campuses will offez specialized degree programs and will eventually offer most if not all of the necessary college:transfer curricula. - CPCC is the number one source of workforce development in the Carolinas. This instiwtion trains and retrains workers from over 700 local businesses. -- Citizens of Mecklenburg and surrounding counties attended classes at CPCC to learn new tnides and to update skills to the tune of 61,368 enrollments last year, according to Cecil Carter, systems analyst for the Planning and Research Department Corporate and Continuing Education instruction represented a whopping 32 percent of the student population; high school completion, GED and literacy courses represented 11 percent of the instruction offered here; two-year degree programs made up 57 percent of the instruction with · college transfer representing 17 percent and nontransfer 40 percent. · -- No matter what program each student on this campus is enrolled bi, the chances are highly probable that he or she will return to community college at some time in the future to update or erμich his or her education. . . -- CPCC is the educational source for that 77 perceni of the population which does not go on to universities to receive a four-yeardegree,.Mostlikelythis77percent will be most affected by the campus expansion. It has the potential to put the education they seek closer to their homes and offices. The pmpose of this editorial is not to persuade swdents to vote for or against the bond referendum. Rath«, the pmpose is to urge each swdent as a registered voter to show up at his or her voting precinct on May 30 and cast an informed vote. For further information concerning the bond referendum, please contact the following members of The CPCC Bond Information Committee: Jim Sasser, 342- 6615; Ervileen Pridgen, 342-6907; Dr. Phyllis Barber, 342-5931; or Judith McGinnis, 342-6666. If you care about the future of Central Piedmont Community College, if you care how your Mecklenburg County tax dollars are spent, if you care about your inalienable rights as an American citizen, do you civic duty: VOTE. Student supports Capital Campaign., bond Dear Editors: My name is Tracie D. Tallant and I am currently the Parliamentarian for the Student Government Association. I have attended Central Piedmont Community College off-and-on for over seven years. I have obtained my High School Diploma, my Associate in Secretarial Science, and am currently working on my College Transfez credits to attend a university. It has become apparent that many of our students are not educated on some of the issues that our College faces. I work diligently eac~ quarter to raise awareness on this campus. Sometimes it is very discouraging to hear students talking about College issues they know nothing about. · The Student Government Association meets every week to help bring awareness to all students. Our General Assembly meetings are held the second Friday of each month (at 12:30 p.m. in Van Every 103) and illl swdents are invited to attend, participate, and get involved. Below I have attempted to simplify two of the map efforts the College is attempting at this time. The Capital Campaign is coordinated by the CPCC Foundation and area business leaders. This campaign is a fund-raising effort to raise approximately 4.6 million from individuals and businesses on campus and in the community. The money raised will benefit several supportive programs at the College, including continuing education, small business assistance initiatives, basic skills equipment, work ethics courses, child care/parenting programs, and neighborhood support sezvices. Workforcedeveloprnentwillalso be supported with Capital Campaign funds. These include Business/Office Technology, Engineering/Machining Technology, Health/Public Safety, Practical Food . Services, and Printing/Graphic Arts/ Commercial Art Programs. CPCC's Bond Issue comes up for votes on May 30. This bond is for 35millionandwillbeusedtobeginCPCCsmovetowardbecomingamulticampuscollege.Thiswillkeepmanystudentsfromhavingtod:riveacrosstowntoattend,andisone.solutiontoourparkingproblems.ThebondmoneywillalsohelpfixtheroofontheGaring«Building.Theareacenterswillbelocatedneartheproposedouterbeltwaysurroundingthecity.Evenblally,withthesupportofouradministrators,faculty,staff,students,businesses,andcommunities,sixCPCCcampuseswillexistTheseincludethe.CentralcampusonElizabethAvenue,theSouthcampusinMatthews,theSouthWest.campusonHebronStreet,theWestcampQSneartheairport,theNorthEastcampusnearUNCCatW.T.HarrisBoulevardandGrierRoad,andtheNorthcampusinHuntersville.IsupportboththeCapitalCampaignandtheCPCCBondandencourageallstudentstodothesame.ContributionscanbemadetotheCapitalCampaignwhenyouregister.PleasesupportCPCCbyvotingonMay30.Sincerely,TracieD.TallantMay1995EditorsPhotoEditorAdEditorPasteupArtistsIllustratorTypesetterStaffWritersStaffPhotographersOfficeAssistantsStudentMay1995TheSparkVol.45No.7MelanieScribnerGaryWeissEricTomtenNancySkonChrisPeiglerTylerRiggsPaulLehnerMickeyBrownJenniferBarringerJohnBradleyAngelMillerNaciMorrisChrisOstleCarlaShoatesMarcusSloanDanaSwaffordEricWellsTomCushmanMansoorKhanJamieRhoadsCarlaShoatesDanaSwaffordPublicationsAdviserLizRogersStudentLifeDirectorMarkHelmsTheSparkisanewspublicationfinancedbystudentactivityfeesandwrittenandpublishedbystudentjournalistsfortheCPCCcommunity.Itisnotanofficialcollegepublication.Anyviewpointsex­pressedshouldnotbeinterpretedasrepresentingofficialCPCCpositions.CPCCisanequalopportunity/affirmativeactioninstitution.Accommodationswillbemadeforindividualswithhearing,sightandphysicaldisabilities.THESPARKwelcomesletters!WearelocatedinTA205,oryoucanmailthemincareofTHESPARKto:POBOX35009Charlotte,NC28235LetterstotheeditorforthenextIssueofTheSparkmustbereceivedbyFriday,June16,1995.Wereservetherighttoeditforbrevityandclarity.AlllettersmustbesignedandshouldIncludeaphonenumberforverification.TheSparkIsprintedonrecycledpaper.Helppreservetheearth.Pleaserecycleourpaper.AdvertisingPolicyTheSparkreservestherighttorefuseanyadvertisingsubmitted.AdvertisinginthispublicationdoesnotreflecttheviewsofeithertheSparkstafforthecollege.May1995TheSparkEnglishmajorwantedOnThursday,April20,anotewasleftonthedoaofStudentPublicationspointingoutawordchoiceerrorinanAprilSporlearticle.Itread,"Youneedtohavesomeoneproofyourarticles!Thiswasonlyoneofthreemistakes,"andwassigned,"ConcernedEnglishMajor."WhileTMSparknormallydoesnotprintanonymouscommentary,theeditorsagreethatthisstudenthasapointDuetothetransientnatureofCPCCsstudentbody,StudentPublicationsisalwaysinneedofpeopletoeditTMSparkandwouldadjurethisparticularstudentaswellasanyotherconcernedorotherwiseinterestedandcaringstudentstobecomeapartofStudentPublications.Althoughtherewereover61,000studentsmatriculatingatthisinstitutionlastyear,TMSparkswriterpoolaveragedbetweenfiveandeightdedicatedwritersperissueandcurrentlyhasnocopyeditors.Weneedallofthestudentsupportwecanget,sobyallmeans.joinusinTaylor205,weekdayaftemoons,andhelpensmethatYOURstudentnewspaperisasperfectaspezfectcanbe.TheEditors,TheSparkOPINION3Aneyeopeningsurvey:sleepinginthelibrarybyNaciMorris,StaffWriterStudentswerepolledatCPCCsIeternationalSpringfest,April26,abouttheirlibrarysleepinghabits.Twentymepm:entsaidthattheysleepinthelibrary;37pezcentofthosewhoadmittedsleepinginthelibrarydosomorethanonceaweek.Thefloorofpreferenceforslumberingwasthefourth.Therewasanequalsplitonthequestionofintenttosleepuponenteringthelibrary.Only38percentofthosewhomakeahabitofsleepinginthelibrarysaidtheypresenttheappearanceofstudying.Fiftyninepercentofpeoplepolledsaidthatsleepinginthelibraryshouldbeallowed.Fortyonepercentofthestudentssaidtheyneverskippedclasses.Whenaskedifthereshouldbeapenaltyforskippingclasses,69percentbelievedthatthereshouldnotbe.Concerningtimespentoncampuseachday,33percentofstudentsclaimedtospendmorethanthreehoursstudying.Fifty­fourpercentsaidthattheyspentsometimeparticipatinginclubsorotherCPCCstudentactivities.And54percentofallstudentspolledspendatleastonehouradayjusthangingoutRovingReporter:Whatareyoursummerplans?IbyOanaSwafford,StaffWriter;PhotosbyTomCushmanStacyWard,22,collegetransfer:"IamgoingtoworkextrahourstomakemoneyforaseasonpasstoCarowindswhereIcanspendthreemonthsontheVortex."Tobia,Wlgard,19,HighSchoolcompktlon:"Iwillbegoingtoschool.OnmyfreetimeIwillbeatthebeachreadingthescriptures."KimCaldwell,20,collegetransfer:"fllbeworkingandgoingtoschool.Onmybreaks111takeacoupleoftripsandrelax."Presidentdiscussesparking,bondsatforumbyJohnBradley,StaffWriterParkingcardswillnotbegoingupanytimesoon,itwasannouncedbyCPCCPresidentAnthonyZeissatthe"CoffeeWiththePresident"forumonApril5.TheannouncementwasmadeinresponsetoanarticleintheMarchissueofTMSparkaboutapossiblepredictedincreaseinthecostofparkingcards,basedoninformationfromFredP.Adams,assistantvicepresidentforoperations.InaninformalmeetingApril24,KathyH.Drumm,vicepresidentofadministrativeservices,confirmedthatnoincreaseineitherdailyparkingfeesorparlcingcardfeeswasforecastthroughtheJuly1995June1996fiscalyear.Itwasalsoannouncedatthepresidentsforumthatthecountycommissionvotedunanimouslythenightbefore(April4)toputthe35 million and will be used to begin CPCC's move toward becoming a multi-campus college. This will keep many students from having to_ d:rive across town to attend, and is one. solution to our parking problems. The bond money will also help fix the roof on the Garing« Building. The area centers will be · located near the proposed outer beltway surrounding the city. Evenblally, with the support of our administrators, faculty, staff, students, businesses, and _communities, six CPCC campuses will exist These include the . Central campus on Elizabeth Avenue, the South campusinMatthews, the South West . campus on Hebron Street, the W estcampQS near the airport, the North East campus near UNCC at W.T. Harris Boulevard and Grier Road, and the North campus in Huntersville. I support both the Capital Campaign and the CPCC Bond and encourage all students to do the same. Contributions can be made to the Capital Campaign when you register. Please supportCPCC by voting on May 30. Sincerely, Tracie D. Tallant May1995 Editors Photo Editor Ad Editor Paste-up Artists Illustrator Typesetter Staff Writers Staff Photographers Office Assistants Student May 1995 The Spark Vol. 45 No. 7 Melanie Scribner Gary Weiss EricTomten Nancy Skon Chris Peigler Tyler Riggs Paul Lehner Mickey Brown Jennifer Barringer John Bradley Angel Miller Naci Morris Chris Ostle Carla Shoates Marcus Sloan Dana Swafford Eric Wells Tom Cushman Mansoor Khan Jamie Rhoads Carla Shoates Dana Swafford Publications Adviser Liz Rogers Student Life Director Mark Helms The Spark is a news publication financed by student activity fees and written and published by student journalists for the CPCC community. It is not an official college publication. Any viewpoints ex­pressed should not be interpreted as representing official CPCC positions. CPCC is an equal opportunity/affirmative action institution. Accommodations will be made for individuals with hearing, sight and physical disabilities. THE SPARK welcomes letters! · We are located in TA 205, or you can mail them in care of THE SPARKto: PO BOX35009 Charlotte, NC 28235 Letters to the editor for the next Issue of The Spark must be received by Friday, June 16,1995. We reserve the right to edit for brevity and clarity. All letters must be signed and should Include a phone number for verification. The Spark Is printed on recycled paper. Help preserve the earth. Please recycle our paper. Advertising Policy The Spark reserves the right to refuse any advertising submitted. Advertising in this publication does not reflect the views of either the Spark staff or the college. May 1995 The Spark English major wanted On Thursday, April 20, a note was left on the doa' of Student Publications pointing out a word choice error in an April Sporle article. It read, "You need to have someone proof your articles! This was only one of three mistakes," and was signed, "Concerned English Major." While TM Spark normally does not print anonymous commentary, the editors agree that this student has a point Due to the transient nature of CPCC's student body, Student Publications is always in need of people to edit TM Spark and would adjure this particular student as well as any other concerned or otherwise interested and caring students to become a part of Student Publications. Although there were over 61,000 students matriculating at this institution last year, TM Spark's writer pool averaged between five and eight dedicated writers per issue and currently has no copy editors. We need all of the student support we can get, so by all means.join us in Taylor 205, weekday aftemoons,andhelpensmethatYOUR student newspaper is as perfect as pezfect can be. The Editors, The Spark OPINION 3 An eye-opening survey: sleeping in the library by Naci Morris, Staff Writer Students were polled at CPCC's Ieternational Springfest, April 26, about their library sleeping habits. Twenty-me pm:ent said that they sleep in the library; 37 pezcent of those who admitted sleeping in the library do so more than once a week. The floor of preference for slumbering was the fourth. There was an equal split on the question of intent to sleep upon entering the library. Only 38 percent of those who make a habit of sleeping in the library said they present the appearance of studying. Fifty-nine percent of people polled said that sleeping in the library should be allowed. Forty-one percent of the students said they never skipped classes. When asked if there should be a penalty for skipping classes, 69 percent believed that there should not be. Concerning time spent on campus each day, 33 percent of students claimed to spendmorethanthreehoursstudying.Fifty­four percent said that they spent some time participating inclubsorotherCPCC student activities. And 54 percent of all students polled spend at least one hour a day just hanging out Roving Reporter: What are your summer plans? I by Oana Swafford, Staff Writer; Photos by Tom Cushman Stacy Ward, 22, college transfer: "I am going to work extra hours to make money for a season pass to Carowinds where I can spend three months on the Vortex." Tobia, Wlgard, 19, High School compktlon: "I will be going to school. On my free time I will be at the beach reading the scriptures." Kim Caldwell, 20, college transfer: "fll be working and going to school. On my breaks 111 take a couple of trips and relax." President discusses parking, bonds at forum by John Bradley, Staff Writer Parking cards will not be going up anytime soon, it was announced by CPCC President Anthony Zeiss at the "Coffee With the President" forum on April 5. The announcement was made in response to an article in theMarchissueofTM Spark about a possible predicted increase in the cost of parking cards, based on information fromFredP.Adams,assistantvicepresident for operations. In an informal meeting April 24, Kathy H. Drumm, vice president of administrative services, confirmed that no increase in either daily parking fees or parlcing card fees was forecast through the July 1995-June 1996 fiscal year. It was also announced at the president's forum that the county commission voted unanimously the night before (April 4) to put the 35 million community college bond issue on the ballot May 30. If passed, the bonds will begin to create an expansion campus system for CPCC, with each campus offering curriculum classes as well as its own specialized programs. Zeiss said that the expansion campuses would help relieve the many parking problems inherent at CPCC' s "land-locked" main campus. The other big issue discussed during the forum was the proposed major budget cuts of three percent this year compared to last year's one percenL Zeiss said that most of the impact would be felt during summer quarter, with curriculum classes being offered. only Monday through Thursday and the number of sections cut back drastically. The Hagem

    The Spark, Volume 46, No. 2

    No full text
    Students crowd the Student Life Center to hear the O.J. Simpson verdict. A list of Student Government Association officers is included in this issue. A student with a disability stresses the sensitivity that should surround people with disability. International students are asked why they've chosen Central Piedmont. Students are asked about their opinion on the O.J. Simpson verdict, which seems to be very similar to the national opinion. The Learning Resources Center (LRC) receives internet, and student access to e-mail will arrive soon. A health sciences bookstore opens up. A Russian attaché visits Central Piedmont. An article highlights the true or false information surrounding the College's expansion. Octoberfest also plays host to a book sale. The Advertising Club gets new officers. Honor contracts is one way students can earn extra credit. The Community Leadership Initiative Program teaches students leadership skills. The history of Halloween is discussed. Dance Central celebrates its 12th season with two different performances. The Russian language comes back as a curriculum course after not being around for 5 years.OCTOBER 1995 - Campus expansion trivia - pg. 5 - Campus activities - pgs. 6-7 Russian language class - pg.12 October 1995 Volume 45 Number 2 Students crowd SLC to hear verdict in O.J. There is no longer an Advisement Day at CPCC. Instead, beginning this quarter, there is Advisement Week, according to a recent press release from CPCC's Academic Advising Center. Advisement Week for the fall quarter is scheduled for Monday, Oct 30, through Thursday, Nov. 2, which is also the beginning of registration for current students. Classes will be in session during this period, but faculty will have scheduled offic6 hours for student appointments. For further information, contact the Academic Advising Center at 342-6302. Simpson case By Melanie Scribner, Editor More than 120 CPCC students, faculty and staff members crowded the Student Life Center on Oct. 3 to hear the verdict in the O.J. Simpson trial. Some students stood on desks, tables and chairs to catch a glimpse of the trial verdict, which was broadcast live on TV. The crowd appeared tense. People talked among themselves and as the verdict was delivered, many onlookers expressed joy by screaming, laughing, congratulating and high­fiving, while others stared in disbelief. Student reaction to the verdict on pg. 3 Photo by Tom Cushman Meet your Student Government Association office:rs Photos by Scott Jones ~ Michael B. Spomer ~45 Title/office; SGA President Degreper ogram;C ommercialA rt/AdvertisingD esign Involvemenitn otherc ampusa ctivities;P TK,A dvertising Designclub,Ex-OfficiomemberCPCCBoardofTrustees, Ex-Officio member Expanded Cabinet, member 5K "Charlotte Skyline Run" committee. High-school graduated from; Lincoln East High, Lincoln, Neb. Current occupation; Shift Manager-Pizza Hut. Projected graduation/transfer date; August '96 Hobbies/interests; Photography; Web-surfing; computer gaming (RPG); cooking; chess; movies; science fiction; politics. Words of wisdom; CPCC in the next few years is going to be going through some major changes. We can't win if we don't play-get involved. ~ Adam Rosenberger ~19 Title/office; SGA Vice President Degreepr ogram;P olitical Science High school graduated from; Providence Senior High School, Charlotte, N.C. · Current occupation; Retail salesman Projectedg raduation/transfedra teT: ransfere ndo f summer 1996. Graduate hopefully '98 or '99. Hobbies/interests; Sports autograph collections, religious studies. Words of wisdom; Life is a journey, not a guided tour. The Student Government Association takes applications for senator positions on a year-round basis and has a few officer positions available. The most recent student to join the SGA team is Gary Jones. Jones is the new Public Information Officer. • ~ Tanika Kimbrough ~20 Title/office; SGA Secretary Degree program; Fashion Merchandising Involvement in other campus activities; Student Government: Conference Committee Chair, "Club Friday" Co-Chair, Constitution Committee Chair High-school graduated from; Providence Senior High, Charlotte, N.C. Current occupation; Volunteer coordinator, service learning . Projected graduation/transfer dale: Spring 1996 Hobbies/interests; My favorite pastime is sewing. I like to bowl and sing. Words of wisdom; I believe that all students need to get involved in some sort of school activity. This will give yout he opportunityto be representedA. wellr epresented student is a happy student 2 OPINION iiifi f 111•1f1~ 111i1111 oltaBltii r•·•·•··········· More about basics: think for ourselves ®m@nf¢ijt@n ppijtff rn Dear Ms Scribner, I read with interest the advice of your writer Tracie Tallant in "Some Basic Basics" in the last issue of The Spark, and on the whole found it sensible and useful. However I was puzzled by her comment about trusting conservative lecturers implicitly and not believing everything the liberal ones said. Did she mean their politics, or their ~vice about exam content? Whatever she meant, shouldn't we remember that in this education process, we should be thinking critically about .all material presented. no matter lYh2p.r esents it? That is, we should be thinking for ourselves. No fear, as the saying goes. Regards, KM Yates Dear KM, llil.lillllilllllii!ll:lil:■il):I::IIriiliMiIlJMlFl i ' ! '%,' ' I couldn't agree rrwre;w e shllukit.h ink for ourselves. It would also be a good idea to not take ourselves quite so seriously. The comment was meant tobe light hurrwr. Sorryifyouwereoffended. Sincerely, Melanie Scribner Student with a disability stresses sensitivity by John Bradley, Associate Editor Have you ever felt trapped in a crowd? The main campus seems that confining to me sometimes. This usually happens when Iamtryingtogetacrosscampusandmanage my cane and my bookbag and trying to figure my circuitous route to avoid as many steps as possible. You see, I am one of the handicapped students referred to in "Some basic basics" in the September issue of The Spark. My point is this: The main campus is not handicap friendly, either in the physical sense or in the sense of people's awareness. The physical problem is inherent to the sloping terrain that the campus evolved upon, before accessibility was an issue. Just to get around campus, sometimes I have to park in a handicapped space on old Kings Drive (if one of the eight or nine is available), go up the ramp into Terrell, take the elevator up one floor, then go up the ramp to Van Every (steep as it is) and then try to use the ramp in front of Van Every if it is empty and usable. This ramp is usually full of perfectly able-bodied students blocking both sides of the ramp, making it useless and unusable. These unaware students are not just on the ramp, they're EVERYWHERE: in elevators, in halls, all around the Quad and even in classrooms. Try going to a class in a small room: I have had to practically knock people out of the way in order to get to a seat And forget the Quad side of Van Every and its first floor lobby: It's way too crowded with too many people who are totally unaware of what's going on around them. So the next time you see someone with an obvious physical disability, please be sensitive to the person's presenc~. Just remember: It takes only one Sl2lit ~ for your whole life to change. Roving Reporter: International Students WhyCPCC? by La'Tasha Crowder, Staff Writer Jim Gonzalez, of PuertQ Rico, chose CPCC "because it's a step' forward" He wants to "get ahead" and "not be another statistic." -. . Hong Kong's Helen Ma said she "heard it was cheaper." Tuition at "UNCC is 4,000;here,its4,000; here, it's 1500," she said. Joomin Lee came here from Korea to learn English. He's "taking a beginning class in sociology" and enjoys the "liberal atmosphere." Shilpa Patel said, "It is a lot cheaper before going to areal university. If you fail a class up there, it is more expensive." Shilpa's native country is India. Konika Poto, also from India, "found out about CPCC from school and heard it was cheaper" and that "there was better help from teachefll." She also heard that it was "easier for ESL students." Mike Heckmann from Gennany said he thinks CPCC was a good choice for him because he and his cousin Elke, also a CPCC student.know students in Charleston and Columbia who are "not very happy with their schools because there are no sport classes." Heckmann' s cousin, Elke Gerstner, also from Gennany said, "We are in a group of 93 people, in 12 states of the United States," she said ''We are young professionals in Germany and the organization [Congress­Bundestag Youth Exchange Program] decides the place we would come [to]. We live with a host family here. We only go for this quarter and after this quarter we take an internship for six months." Christoph Buhrer, Switzerland; and attends CPCC to learn English. "I live with my uncle here in Charlotte." His uncle recommended CPCC. Christoph tried it and liked it. "I think it's a good school for me," he said. October 1995 The Spark October 1995 Vol. 46 No. 2 Editor Melanie Scribner Associate Editor John Bradley Photo Editor Karen E. Abbott Advertising Editor Ted Garvin Copy Editor Gary Weiss Paste-up Artist Marie Kepley Chris Peigler Typesetter Mickey Brown Staff Writers Staff Photographers Student La'Tasha Crowder Franklin Diaz Shannon Kendall Angel Miller Darryl N. Parker, Jr. Katherine Waddell Tom Cushman Tracy Douglas Gerald Hadaway Scott Jones Christina Raynes Publications Adviser Liz Rogers Student Life Director Mark Helms The Spark is a news publication fi­nanced by student activity fees and written and published by student journalists for he CPCC community. It is not an official college publication. Any viewpoints ex-pressed should not be interpreted as representing official CPCC positions. CPCC is an equal opportunity/affirmative action institution. Accommodations will be made for individuals with hearing, sight and physical disabilities. , THE SPARK welcomes letters! e are located in TA 205, or you an mail them in care of THE SPARKto: PO BOX35009 Charlotte, NC 28235 Letters to the editor for the next Issue of The Spark must be received by Friday, Oct. 27, 1995. We reserve the right to edit for brevity and clarity. All letters must be signed and should Include a phone number for verification. The Spark Is printed on recycled ,paper. @ Help preserve the earth. Please recycle our paper. Advertising Policy The Spark reserves the right to refuse any advertising submitted. Advertising in this publication does not reflect the views of either the Spark staff or the college. ,. October 1995 The Spark OPINION 3 Roving Reporter: Student opinion on the O.J. Simpson verdict closely mirrors national opinion By Melanie Scribner, Editor Photos by Tom Cushman Standing in the Student Life Center on Oct. 3, watching reaction from various members of the CPCC community, I have to admit that I was stunned. The reaction of the crowd mi"ored that of the entire United States:O pinionsin stantaneouslpyo larized. However, what happened on this campus differed in that, altlwugh at first the lines appeared to be clearly drawn, black and white, it was not a complete racial polarization. Some African-Americans wJw watched the verdict in the SLC expressed to me the belieft hatw hilet heA mericanju stices ystem was served in this instance, perhaps llJJ& justice was not served. Some white Americans on this campus, Jwwever, believe Simpson received a fair trial and the question of reasonable doubt is what set himfree. For my part, I have questions. I question whether or not Americans on either side of this issue are listening to each other. I hear a lot of talking going on, but are we talking lJl. each other or QJ. each other? Are we listening at all? If ever there was a perfect time to start a dialogue among diverse peoples, isn't that time now? The following commentary was given within an Jwur of the jury's decision. How do we find the answers to the questions raised by this verdict? The Spark welcomes questions and comments. Perhaps we can work this out to~etheTr.a lk to us. Mike Heckmann (right) Tanika Kimbrough, 20, fashion merchandising and SGA secretary "I think justice was served. I don't think the prosecution proved he was guilty without a reasonable doubt I commend the jurors." Jacotron Andre Potts, 20, college transfer and BSO president "This country has always believed in the justice system. I wonder if they feel the same way now." Bruce Dilger, culinary arts and SGA senator, said, "I won a dinner tonight. I bet he [Simpson} would either get off or the jury would be hung." Dilger said he based his opinion on the fact that an illegal search was done on Simpson's home early in the investigation. "I wasn't betting guilt or innocence, rather whether or not he got off or not" Dilger further said, ''The defense painted a picture of him [Simpson] as a human being." OfficerT.N. Kennedy,otT-dutysecurity, Charlotte-Mecklenburg Police Department, said, "I think the verdict that came down was definitely one of justice. That's not to say-OJ. isn't guilty. Mark Furman' s testimony had a lot to do with the verdict." Adam Rosenberger, 19, college transfer and SGA vice president "Basically, I felt the jury made the best Deron Gilford Correction An error occurred in the September issue of The Spark· in an article entitled "Campus Printing expands services to include students." According to Linda Nardelli, head of Campus Printing, at no time were the employees of Campus Printing in danger of being laid off. Sonia Hollie (right) with a friend decision ·to their best judgment. This case was brought out of proportion. The media trashed it No one knows the truth except OJ., Nicole and Ron." Mike Heckmann, 21, German exchange student "I have a problem because I didn't follow the trial. They didn't cover it in Germany the way they did here. I think it's better for the U.S. that he's not guilty." Rolf Schwarz, 19, German exchange student, said,"I think they came to a conclusion too quickly. It was a year-long trial, but they came to a conclusion in what? Three hours? The big question is, if OJ. didn't do it, who did?" Sonia Hollie, 18, paralegal technology "I'm happy the truth came out and that justice was served. I hope no one should have to go through what he just did this past year." Deron Gilford, 18, college transfer "I'm just happy it's over with." Adam Rosenberger talking to roving reporter ••WI I I I 8 I I Ii I I I W ■ I•• :• Spark e-mail • • • • • address • The Spark can be reached through the : Internet via e-mail at: ••• • : E-mail us your comments and news • tips! • • • • • • ...,., ,,,,,,,,,,. ... _ 4 CAMPUS NEWS Internet in the LRC, student access to e-mail in the works by Franklin Diaz, Staff Writer A room on the second floor of the Leaming Resources Center is now home to a group of computers where students can access the Internet. A meeting was held on Sept 8 to discuss the possible expansion of the servjces available to students. In attendance were staff members from Computing Services, Student Life and the LRC, as well as representatives of student government and student publications. Issues discussed included the future of student Internet electronic mail capabilities fromcomputersconnectedtoCPCC's.local area network, and the proposed scope of computing students will have access to. "Although access to the Internet has been available since last winter quarter, we needed time to get things organized and the staff trained," said Bryan Yerke, a software technician with Computing Services. "We use Netscape, which is a relatively painless means of getting around on-line." Yerke also mentioned that while any machine attached to CPCC's LAN will be capable of providing mail capabilities, how individual machines are used is still up to the departments the computers belong to. "Computing Services will provide connectivity. Student Life will be responsible for negotiating with different departments the actual allocation of capabilities," Yerke said. Before students can get an e-mail account through the college, a computer dedicated to the maintenance of the accounts must be procured. The staff at Computing Services hopes to train an individual to do the actual work, under the direction of Student Life. "We're looking for funds to purchase a server," said Charles Cox III, Senior Computer Operations Supervisor at Computing Services. "Hopefully things will come together in the next couple months." "We've forwarded a proposal to Dr. Gennett [ vice president of education support services] in the hopes of getting $3,500 for equipment," said Dr. Melvin Gay, dean of student development Initially, the e-mail accounts created would be used by SGA and members of student organizations. The goal is to set up a system wherein students might simply request, and get, an account from the proposed net-mail administrator(s) of Student Life. "Internet access for individuals may come in the form of a new computer in the Like to write? Find people and events fascinating? Want to get involved in campus activities? Want to have fun while learning? 'Cite Spark staff seeks idea oriented writers to enhance the quality of StuJt?.nt 7)u6tuatl"ns. Apply in person weekday afternoons: St11de1P11t 1blic11tio1ts Taylor Hall, Suite 205 or call 342-6665 for further information. reference area of the LRC," noted Dr. Carole Schultz, director of the library services department "Monday through Thursday from 5 p.m. to 9 p.m., and Saturday from 10 a.m. to 2 p.m., students can come in and take advantage of our current setup." "We are currently focusing on classes, which take precedence, andstudentresearch to supplement classwork," Schultz continued. "Getting students on-line would be a great way to let folks know about library activities, anq enhance faculty­studentc ommunicationsI.f we can get the funds for a server, our only worry will be the anticipated volume of requests for October 1995 The Spark student accounts, possibly upwards of 10,000 students." CurrentSGA Pr~ident Michael Spomer foresees the need for more workstations students can use. "The last thing we want is to disrupt classes. Many of the places students might take advantage of the proposed services are primarily dedicated to classwork and instruction. We are looking forward to linking CPCC with other campuses." Also suggested at the Sept 8 meeting was an SGA homepage on the World Wide Web. *Check out the CPCC HomePage! Health Sciences bookstore opens by Franklin Diaz, Staff Writer The CPCC Health Sciences Bookstore is now open for business. Store hours are 9 a.m. to 6 p.m. Monday through Thursday, 9 a.m. to 4:30 p.m. Friday, and 9 a.m. to 1 p.m. Saturday. The bookstore's proposed drive-thru book buyback is not operational yet, as the back of the building is currently being used as classroom space. Russian attache visits CPCC Information obtained from a CPCC marketing department press release. Dmitriy Korayagin, the Russian attache in Washington, D.C.,. visited CPCC Aug. 23 through 25. Bill Disher, CPCC Board of Trustees chairman, and President Tony Zeiss, CPCC president,w erei n Washingtonla stF ebruary to meet and talk with N.C. federal legislators. During that visit, Zeiss was asked if CPCC had Russian students, because Koryagin wanted to know more about the community college system. Zeiss and Disher met with Koryagin at the Russian Embassy in Washington and invited him to see the N.C. community college system at work during a visit to the CPCC campus. Koryagin, his wife Elizabeth, and their 5- year-old daughter, Kate, were guests of the college Aug. 23 through 25. "It was a delight to have Mr. Koryagin and his family with us," Zeiss said. "The fact that they all spoke English, including 5-year-old Kate, made it easier for us to share the mission and vision ofCPCC with them." "Koryagin was very interested in how CPCC fulfills its work force development function and appreciated the importance of the college to the area's economic development effort," said 2.eiss. "It was a very fruitful and enjoyable visit." Russian Itinerary Kory.aginto ured the main campus Aug. 24. He visited the Auto Tech Center, Advanced Technologies Center, Small Business Center and Corporate and Continuing Education. He also met with Richard Zollinger, director of the CPCC International Business Program; Michael Mastromichalis; and Dan Manning, associate dean of the enrollment services department; and Michael Spomer, SGA president. The remainder of his visit was spent meeting with city and county officials and business leaders and touring the city of Charlotte. Typing/Word Processing Prices for the students wallet Professional and prompt Call Cynthia at 532-417 4 October 1995 The Spark CAMPUS NEWS 5 Campus expansion trivia: true or false? by Melanie Scribner, Editor Test your campus expansion know-how! Answer true or false to the following questions and see how CPCC savvy you are: 1. The ABLE Center Is currently houseda t the NorthC enter. .Ea1.Tsh.ee. A..B LE (AdultB asicL iteracy Education) is spread out at various Charlotte community locations including Freedom Drive, Beatties Ford Road and the Central YMCA. With the completion of expansion campuses, these locations should remain where they are in order to be best equipped to help the citizens who access them. 2. The Northeast campus will be the first expansion campus to break ground. .EaJsT.eh.e. .S outh Campusw ill be the first expansion campus to break ground. The South Center currently has the most students enrolled of all the area centers and they have the most immediate need for a new campus as the lease on the building the South Center is in is about to expire. The Northeast

    The Spark, Volume 8, No. 1

    No full text
    TIie CENTRAL Pl EDMONT COMMUNITY C0Lt.£GE • Taylor Hall 102 Charlotte, N~,Parc>Una volume 8 Number 1 September 29~1983 SPECIAL EDITION THE ABLE PROJECT ----- A New Direction by Mary Lou Diaz Spark Staff Writer Have you every wondered what it would be like if you couldn't read or write? In a 1970 census, over 50,000 adults in Mecklen­burg County were found to be under the illiterate level of the seventh grade in reading and math. Think how discouraging it would be to go job searching and be unable to fill the appli­cation out! It doesn't have to be that way in Charlotte, thanks to ABLE! The ABLE (Adult Basic Liter­ary Education) project is doing a tremendous service for our community. Dr. Terrilyn Turner, the former planning director, helped this opportunity become a reality . Dr. Turner chose the type 0f equipment and the initial approach which would be most effective. She along with assistance from a community advisory committee, selected the location for the project, the West Area Learning Center in Freedom Mall. ABLE, thanks to Dr. Turner, utilizes the newest known ap­proach to literacy, the use of the Apple and Plato computers, sound slides, video tapes, print materials and individual tutoring. These tools enable students to learn at a faster rate, according to Cindy Wilson, currently acting as planning director. Mrs. Wilson states that never before has such a concentrated effort aeen made to help indi­viduals learn to read and write along with improving math skills. Mrs. Wilson's desire is to continue the efforts already in progress at the center and wishes to see a growth of more volunteers and students. Hy use of concentrated tech­niques a student may advance one grade level after twenty hours in reading on the system, and one grade level after twenty­five hours in math. Potential students are tested, and if they fall below a seventh grade literacy level, they are encouraged to begin tutoring immediately. The ABLE Center is a free service and open to anyone in the community. lt is staffed with teachers and volunteers and currently has an enrollment of 170 students. If anyone is interested or wants further information, please contact the ABLE Center: 3 73- 6971. The days are Monday thru Friday : 10 a.m. to 9 p.m. and Saturday: 10 a.m. to 6 p.m. The center is proud of its open­door policy. Students may come and go as their schedule permits during operating hours. EDITORIAL by Mary Lou Diaz Spark Staft Writer Are you aware that today in the age of advanced technology and _computers, there is still an estimated fifty thousand adult illiterates living in Mecklenburg County, according to a 1970 census. Nationwide over half of all prison inmates have inade­quate reading skills, and 90% of all AFDC mothers are illiterate. 1 strongly feel that we are losing sight of our most precious asset, human beings, and as a result; the human mind by not investing more in education of future generations. Increased technology is good, but the God given gift of the brain must be exercised and taught early in life. I think that there is not enough emphasis being put on motivating our children to learn to read and write tram the beginning. We are leaving the persons behind without hope with all the advanced pleasures we have achieved. Persons who have not mastered reading and writing skills are finding it more diffi­cult to rind a job. Can you imagine the day to day frus­trations just trying to exist? I am thrilled when I have an opportunity to speak with some­one who has actually encountered this problem, and who has a very bright future ahead because of organizations like the Adult Basic Learning Education. The person I interviewed wishes to remain nameless for personal reasons, but 1 feel she really deserves an applaude for her great effort to learn to read and write . She informed me of the tremendous struggle just to live m todays society, because every­one just assumes that one auto­matically can read in every aspect of life. I could really feel the pain and embarrassement she went through before the ABLE center became a mile­stone in her life. AHLE 1s attempting to help those who are in need of improv­ing reading and writing skills through microcomputers and personal tutoring. Cindy Wilson , acting director of the center has a genuine concern with each individual student and I wish to praise their great success! 1 hope that those who know someone who needs this help will be friend enough to tell them of the AHLE Center and encourage them to inquire about it. lt is completely free of charge, and has an open door policy. Learning can be very rapid. Taking a caring part in our community can be so rewarding, by guiding someone to this center and possibly changing their lives. It's a great sense of accomplishment and personal satisfaction to be able to pitch in and help better our fellow man. Inmates Tour Campus By Victor Alexander Assistant Editor Twenty-five inmates from Meck­lenburg 1 Correctional Facility paid a visit to CPCC to receive first-hand observation of the college last month. The tour was in connection with a transitional program aimed at revitalizing the inmate's aware­ness toward society. Harold Winston, Training Coordinator, of the program said, "the inmate's tour places where they can receive educational training once they get out in society." The program covers self reliance, vocational studies, family and community relations. Winston explained, "the program strength­ens and revives the inmate's awareness and horizon to relieve the pressures of society." William H. Quilliaws an inmate completing his 7-year sentence said, "the program reintroduces us to society, it makes us aware of the services that may be available since we were taken away." One inmate who declined to be idenitified said, "this pro­gram is good for the young guys because many times when we are young we go wrong and need that second chance." This un­identified inmate is a 21-year old miltary veteran and a graduate of Pembroke State University. After touring the Auto Me-chanics Shop, the Music Building and Taylor Hall recreational facilities Quilliaws said, "this seems like a good place to start a new life in society. I will be ready for it." Students Attend USSA Conference Leelannee San Jose' Spark Staff Writer The United States student Association held its annual con­ference July 21 -25 at Emery University in Atlanta, GA. A total of 250 delegates attended representing 3 2 states. The pur­pose of this conference was to bring together schools of our nation to act as a single force as they do in the United States Government. Central Piedmont Community College was represented by Doug Huneycutt and Ricky Reid , who serve as Treasurer and Vice­President, respectively, for the North Carolina Comprehensive Community College Student Government Association. Doug is also President of CPCC's Student Council. "In North Carolina we are lucky, especially community colleges, that we work so well with our Admini­stration. Our State Student Association is a well run organized group,'' according to Doug. The group attended workshops where they had panel discussions on subjects such as student roles on the Board of Trustees; setting and spending student activity funds. During these workshops everyone was able to hear from other students across the nation on how these problems were handled on their campus. As a result of this conference, massive voter registration drives are going on all over the country to en­courage registered students to exercise their right to vote. While in Atlanta, the prospect of forming a Mecklenburg County coalition group for Student Government Association students from UNCC, Davidson College, J. C. Smith University, and Queens College was also disucssed . The United States Student Association Lobby Conference will be held in February of 1984 in Washington, D. C. I '0 :r .0.. 0 "' a- -= 0 l>l ::, (0 0 l>l <: "' THE LEGEND OF HOUDINI COMES ALIVE by Sharon Berry Spark Staff Writer Don Viano, world renowned daredevil and escape artist, ap­peared on the mall on Tuesday, August 22. He mesmerized the audience with stunts that have made him known as the ''twin'' of the famous Harry Houdini. In fact, he is the first magician to discover Houdini's inner magical secrets. Viano is 54 years old and his home is in Warren, Michigan. He started performing magic at the age of 12 when he was given a magic set by his mother for Christmas. He would then per­form for his family as well as neighbors and friends. He started professionally doing escape acts 14 years ago . His most tamous act is a duplication of Houdini's Water Torture Cell. He is dropped into a water tank with his hands handcuffed and feet locked to the top of the tank, in which the water is several feet deep. He has 3 minutes to get out. Another one of his exciting stunts is a guillotine act in which he has less than 1 minute to escape from a fire blazing guillotine and handcuffs. Both were per­formed successfully and with great expertise. He is married and his wife assists him on his stunts. ''I lay my life on the line in ev.:ry act. I do more stunts than a magician.", says Viano. He keeps his costumes simple because of the dangerous acts. His costune usually consists of a simple red turtleneck shirt and black pants. The same goes for his assistants. He loves traveling to interest-ing places and meeting people. "We're real happy to be here. I hope everyone enjoys it. lt's like meeting a whole bunch of new friends every time I do a show.'', he said. His touring schedule varies. Sometimes he does 20 shows a month, some­times 5. Fall Festival in Planning by Phyllis Barnette Spark Staff Writer To help make a successful beginning for the fall quarter, the Student Activity Association will sponsor a "Fall Fest iv al." This great day will take place on October 26 at 10 a.m. to 2 p.m. There will be all sorts of fun ranging from the dunking booth, selling food, to the sound of a live band. There will also be many club activities. Clubs and Program Area Committees will be out to show and tell students what they can be involved in . According to Student Association members, it's to give the students an "early break" and ''just plain fun. ' ' FEAT MOVIE REVIEW Sharon Berry Spark Staff Writer Remember the saying, "All work and no play makes Jack a dull boy.''? That definitely applies to this movie. The story is about the misadventures of Skip and Jonathan, both roomates at the prestigous Vernon Academy. Skip is the son of one of the country's wealthies men, as well as the school prankster. Jonathan is a new student who was admitted by cheating on the Standard Achievement Test. Skip and Jonathan are played by two very talented actors, Rob Lowe and Andrew McCarthy respective­ly. Both are very impressive in their roles. In the beginning, Jonathan is the victim of Skip's embrrassing jokes, such as saying that it is traditional for Senior men to dress in womens' underwear. Jonathan tries it and is embarrassed when he is the only one dressed that way. At one point, Skip gets the message that Jonathan is having problems with girls and advises him to go to a sleazy bar in Chicago to meet a girl. He has an affair with a girl who turns out to be Skip 's mother, played brilliantly by J aqueline Bisset. This film is wacky and brings a lot of laughs. A definite must­see! GOT a NEWS TIP? SPARK hotline 373-6665 by Victor D. Alexander Spark Association Editor Twenty years from now, l '11 tell my children or grandchildren about the March of '83. How we marched with dignity and respect for the dream of equal justice and economic oppor­tunity. How we gathered at the Lincoln Memorial to comme­morate the 20th Anniversary of the historic March on W ashiry:gton. As representatives from CPCC 's Afro-American Cultural & Edu­cational Club and the student newspaper (The Spark), we joined an estimated 2)0,u00 American from diverse coalitions, and more than 700 groups with a wide range of political and social agendas demanding every­thing from government 'job pro­grams to a nuclear free_ze to gay rights. Nevertheless, their unifying theme was "Jobs, Peace, and Freedom." What Carrie Graves, Charlotte Southern Christian Leadership Conference {SCLC) calls ''The three most essential issues concerning people today.'' Another important issue, which was unquestionably one stimulus for the March was the goal of ousting President Ronald Reagan in the 1984 presidential elections. "This is a warning to Mr. Reagan that we do mean business in his eviction from the White House;' said William P. Spann one ofthe three students representating the AAC &EC. Benjamin Hooks, executive director of the NAACP, who led thousands in a chant of ''Reagan No More In 84'' said," We are up to here with Reagan and, we are committed to the elimination of Reaganism from the face of the earth.'' March on Washington II, as It was billed by the organizers, who described themselves as a New Coalition of Conscience, drew about the same turnout as the orginal historic gathering twenty years ago, called by labor, religious and black leaders to mobilize support for the civil rights legislation stalled in Congress. Police said," The 1500 buses that came to the Washington area came in numbers that surpassed the 1963 March.'' Like the 1963 gathering, the event was peaceful and relatively problem-free considering the im­mense logistical tasks of gathering, moving and tending to the needs of sweltering multitudes through­out an 11-hours program that did not end until after 7 p .m. Jonathan V . Davis, Editor of The Spark and Exeq1tive Hoard member of the AAC & EC stated, "It really mspried 'me. ~..:? It mak_es me realize tha-t there are more blatks inteFested iH the civil rights movement today than I expected, but the question is_ what w!ll fol1ow the March, and what paths will black leaders pursue, as fighting - for -jobs, peacr, and_freedOIJ1. (J('~ T)le day was long and hot: more than 6UQ marchers were treated fGr heat exhau~tion as, temperatures reached 9S. The oratory too was long, as speak(:}r alter speaker tried to recr.eate tl}e intensity ot King,'s 1963 ''I Have Pi:. Dream'' speech that galvanized the civil rig]:its move­ment. "We must ctream new dreams,'' shouted the Kev. Jesse Jackson, head of Op~ration PUSH and a possible ca11didate for President. "Uur day has come, don't le! them bres1k your di:gam.' ' Women who were almost overlooked w'hen it ~ came time to prep.aring the program for the 1963 March, appeared . to Jutnltmber the men this time, and tlieir c9ncerns .and politica clout wer-e highly visible," We will change the political fand- ~77 . I Hall. The new facility is to be finished around August of next year. The bookstore will be relocated in a 9,000 square­foot building to be built between the Music Building and the Central Forum Cafeteria. Jack Mullis, Plant Operations Manager said he doesn't know definitely when they will start plans for the bookstore until decisions are made by the architect. Mr. Mullis believes it can be built for 350,000butthebookstorerevenuesof350,000 but the bookstore revenues of 100,000 will go toward con­struction with the CPCC Foun­dation paying the balance, not to exceed 250,000.FredAdams,BookstoreMan­ager,expectsaIOpercentincreaseperyearinsales,andthestoresuntoldofferingswillreceivemoreartsupplies,tradebooksandgeneralreadingandsupple­mentalbooksforcurriculumprograms.STRICTERPENALTIESIMPOSEDONNCDRUNKDRIVINGLThe"KoadsAct,effectiveOctober1,1983isacomper­hensiveandtoughrevis10nofNorthCarolinaslawondrunkdriving.Itrepealsthepresentlawsandreplacesthemwiththesingleoffenseof"DrivingWhilelmpairedDWLThelawraisestheagetobuyandpossessbeerandunfor­tifiedwineto19.Legalagetobuyorpossessfortifiedwineorspirityousliquorremains21.ThereisnoliabilityforrefusingtoselltoorserveacustomerwhocannotproduceavalidIU.AsalespersonmayholdacustomersIDforareasonabletimetocheckitsvalidityifthesellertellsthepersonwhyitisbeingheld.Negligentsaleofbeer,wineorliquortoanunder­agepersonmaysubjectasellertocivilliabilityiftheminorconsumesthebeverageandasaresultofconsumingthatbeveragehasanaccidentwhileimpaired.Adirvermaynotconsumeanyalcoholicbeverageswhiledriving.Anypersonconvictedofanimpaireddrivingoffensewhile,his/herlicenseisrevokedforanearlierimpaireddrivingoffensecouldforfeithisvehicle.DWIcanbeprovenoneortwoways:1)Byprovingthedriversphysicalormentalfacultiesareappreciablyimpairedbyalcohol,drugs,oracombinationofthetwo,and2)Byprovingthedriversalcoholconcentration(AC)is0.10ormoreatanyrelevanttimeafterdriving.IfapersonischargewithDWI,thechargecannotbereducedtoalesserincludedoffense.OncechargedwithDWl,adriverrefusestobetestedorwhohasanalcoholconcentrationof0.10facesanautomaticandimmediate10dayrevocationofhisorherlicense.Noonenotobtainalimiteddrivingprivilegeforthisperiod.AlteraDWIconviction,thetrialjudgewillholdasentencehearingtodeterminepunishment.Thelawestablishesfive(5)levelsofpunishmentdetermmedbyevidenceofgrosslyaggra­vating,aggravating,andmitigatingfactors.GrosslyAggravatingFactorsAre:Twoormoreconvitionsforanlillpaireddrivingoffensewithin7years;Apnorconvictionforanim­paireddrivingoffensewithin7years;"Drivingwhilelicenseisrevokedunderanimpaireddrivingrevo­cation;"Seriousinjurytoanothercausedbydefendantsimpaireddriving.AggravatingFactorsAre:Grossimpairmentoranalcoholconcentrationof0.20ormore;Especiallyrecklessdriving;Negligentdrivingleadingtoanaccidentcausingover250,000. Fred Adams, Bookstore Man­ager, expects a IO percent increase per year in sales, and the store's untold offerings will receive more art supplies, trade books and general reading and supple­mental books for curriculum programs. STRICTER PENALTIES IMPOSED ON NC DRUNK DRIVING 'L The '-'"·- Koads Act, effective October 1, 1983 is a comper­hensive and tough revis10n of North Carolina's law on drunk driving. It repeals the present laws and replaces them with the single offense of "Driving While lmpaired- DWL'' The law raises the age to buy and possess beer and unfor­tified wine to 19. Legal age to buy or possess fortified wine or spirityous liquor remains 21. There is no liability for refusing to sell to or serve a customer who cannot produce a valid IU. A salesperson may hold a customer's ID for a reasonable time to check its validity if the seller tells the person why it is being held. Negligent sale of beer, wine or liquor to an under­age person may subject a seller to civil liability if the minor consumes the beverage and as a result of consuming that beverage has an accident while impaired. A dirver may not consume any alcoholic beverages while driving. Any person convicted of an impaired driving offense while , his/her license is revoked for an earlier impaired driving offense could forfeit his vehicle. DWI can be proven one or two ways: 1) By proving the drivers physical or mental faculties are appreciably impaired by alcohol, drugs, or a combination of the two, and 2) By proving the driver's alcohol concentration (AC) is 0.10 or more at any relevant time after driving. If a person is charge with DWI, the charge cannot be reduced to a lesser included offense. Once charged with DWl, a driver refuses to be tested or who has an alcohol concentration of 0.10 faces an automatic and immediate 10-day revocation of his or her license. No one not obtain a limited driving privilege for this period. Alter a DWI conviction, the trial judge will hold a sentence hearing to determine punishment. The law establishes five (5) levels of punishment determmed by evidence of grossly aggra­vating, aggravating, and mitigating factors. Grossly Aggravating Factors Are: *Two or more convitions for an lillpaired driving offense within 7 years; * A pnor conviction for an im­paired driving offense within 7 years; "'Driving while license is revoked under an impaired driving revo­cation; "'Serious injury to another caused by defendant's impaired driving. Aggravating Factors Are: *Gross impairment or an alcohol concentration of 0.20 or more; *Especially reckless driving; *Negligent driving leading to an accident causing over SOU damage or personal injury; "'Driving while license revoked; *Two or more prior convitctions of a non-impaired driving offense carrying 3 driver's license points within 5 years, or one or more prior convictions of an impaired driving offense more than 7 years old; "'Speeding to elude arrent; *Speeding more than 30 mph over the posted limit; *Passing a stopped school bus; "'Any other aggravating factor. Mitigating Factors Are: "'Slight impairment solely from alcohol, with an AC not exceed­ing 0.11; *Slight impairment, solely from alcohol, and no chemical test available to the defendant. "'Safe and lawful drivmg except for impairement of defendants facilties; "'Safe driving record- no serious traffic violations within ) years of the offense; *lmpairement primarily from lawfully prescribed drug. *Voluntary submission for assess­ment and treatment before trail. * Any other mitigating fa ctor. Levels of Punishment Where grossly aggravating factors represent: Level 1 If two or more impaired driving offenses within 7 years, or any other two grossly aggravating factors are present, punishment is a mandatory minumun of 14 days and up to 2 years in jail. A fine of up to 2,00Umaybeimposed.Level2lfonegrosslyaggravatingfactor(othertowormoreimpaireddrivingoffenseswithin7years)ispresent,punishmentisaman­datorymmimumof7daysandupto1yearinjail.Afineof2,00U- maybe imposed. Level 2 lf one grossly aggravating factor ( other tow or more impaired driving offenses within 7 years) is present, punishment is a man­datory mmimum of 7 days and up to 1 year in jail. A fine of 1,U00 maybe imposed. Where no grossly aggravating factors are present: Level 3 If aggravating factors outweigh mitigating factors, punishment is a minumum of 72 hours in jail, or 72 hours of community service, or a 90-day revocation ot driving privileges, or any combination of three. A fine of up to SOUmaybeimposed.Level4lfneithersetoffactorsoutweighstheother,punishmentis48hoursinjail,or48hoursofcommunityservice,ora60dayrevocationofdrivingprivi­leges,oranycombinationofthethree.AfineofuptoSOU- maybe imposed. Level 4 lf neither set of factors outweighs the other, punishment is 48 hours in jail, or 48 hours of community service, or a 60 day revocation of driving privi­leges, or any combination of the three. A fine of up to 250- maybe imposed. Level 5 If mitigating factors outweigh aggravating factors, punsihment is 24 hours in jail, or 24 hours of community service, or a JO day loss of driving privileges, or any combination of the three. A fine of up tolu0maybeimposed.LLllJ.iqwnNl!WJ.IJ"J"N.111ope4JOIVd39VlSOdsnNOilVZINV9 011.JO dNONThisnewlawwillforcepeopletothinktwicebeforetheydrinkanddriveduetostifferpenaltiesthatwillbehandeddownuponconviction.Muchstifferthantheyhavebeeninthepast.Editor.........JonathanUavisAsso.Editor..VictorAlexanderPhotoEditor......BetsyBowenAssign.Editor.LeelanneeSanJoseUistribtionMgr..WilliamSpannLayout..........JodieHartisWritersSharonBerryPhyllisBarnettePhotographersBetsyBowenSharonBerryKatherinePottsOremaAlexanderMaryLouDiazWilliamSpannTypistSandraHillJimmySimsTypesetterMonciaRankinDirectorofStudentActivities..................RossSurphlisPOLICYTheSparkisaStudentPublication,financedbystudentactivityfo:s,written,editedandpublishedbystudentjournalistsfortheCPCCcommunity.Itisnotanofficialcol­legepublication,andanyviewpointsexpressedhereinshouldnotbeinterpretedasrepresentingofficialCPCCpositions.TheSparkhaspositionsopenforBusinessManager,writers,photographers,andreporters.ContactTheSparkofficeat373666)MelindaorBillMartinBrittanySpanielpupsChampionHloodLine,9weeksold lu0 maybe imposed. LL l l J.iqwnN l!WJ.IJ "J "N '.111ope4J OIVd 39V lSOd ·s ·n NOil VZINV9~0 11.JO~d-NON This new law will force people to think twice before they drink and drive due to stiff er penalties that will be handed down upon conviction. Much stiffer than they have been in the past. Editor ......... Jonathan Uavis Asso . Editor .. Victor Alexander Photo Editor . ..... Betsy Bowen Assign. Editor. Leelannee San Jose' Uistribtion Mgr . . William Spann Layout ... . .. .... Jodie Hartis Writers Sharon Berry Phyllis Barnette Photographers Betsy Bowen Sharon Berry Katherine Potts Orema Alexander Mary Lou Diaz William Spann Typist Sandra Hill Jimmy Sims Typesetter Moncia Rankin Director of Student Activities ... . .. ... ....... .. Ross Surphlis POLICY The Spark is a Student Publication, financed by student activity fo:s, written, edited and published by student journalists for the CPCC community. It is not an official col­lege publication, and any viewpoints expressed herein should not be interpreted as representing official CPCC positions. The Spark has positions open for Business Manager, writers, photographers, and reporters. Contact The Spark office at 373-666) Melinda or Bill Martin Brittany Spaniel pups Champion Hlood Line, 9 weeks old l"/5 ea. males and females Call 537-6447 DON'S HOME SERVICE WILL HELP YOU MOVE FOR 15/hour.WehaveapickuptruckcanhaulanythingCall)2570U668BMW160U2DK4SPtrm.,15/ hour. We have a pick-up truck can haul anything Call ) 25-70U6 68 BMW 160U 2DK 4SP trm., 2,800 393-1451 AL HAYES :ing s y e, an e eau y o well-kept campus. CPCC is C',..,.,...f11n 'lto tn 1,':ll.TP larl\T Sfl8l "J"N 'a11op,4J 600S£ xos ·o · d S.lll!A!lJV 1u.1pn1s JO .l)!JJO A )U.18\( SUOl ll' )!(qnJ 1 u.1pn1s .18.1110J Al!Unl..UWOJ 1uowp.1!J ll'JlU.I
    corecore