7,407 research outputs found

    Universitas: the magazine of Saint Louis University

    No full text
    Fall 2003 issue of Universitas: the magazine of Saint Louis UniversityT H E M AG A Z I N E O F S A I N T L O U I S U N I V E R S I T Y F A L L 2 0 0 3 By Lawrence Biondi, S.J. Saint Louis University President I’m convinced that it must have been a SLU graduate who coined the phrase, “What a small world.” I’m sure you’ve all had a similar experience: you’re sitting in a restaurant, standing in line to check out at a grocery store or even taking in a ball game, and someone around you says something like, “Didn’t you go to SLU?” Whatever the opening line, what almost always ensues is a brief conversation between two people. They may have never met before, but it’s as if an instant connection has been made. They begin talking like old friends. Although I realize that this phenomenon frequently happens between people who share a common identity, I often come away from such experi-ences convinced that members of our SLU community transcend the superficialities of just sharing an alma mater or even a fondness for a particu-lar sports team. I truly believe our mission and our Ignatian heritage unites us on a deep-er level. The recent Homecoming festivities only reinforced my belief. As all of you know, during Homecoming, we welcome thousands of former students back to campus, putting them in contact once again with each other and with our current students, faculty and staff. There were tours of Grand Center, our own home in Midtown, as well as the new and improved Busch Student Center. There were parties, outdoor concerts, Billiken soccer, a parade and fireworks. There were golf outings, class reunions and tailgates. And serving as an appropriate, intimate ending to the weekend, there was the Golden Billiken Brunch for members of the classes up to and including the class of 1953. Alhtough all of these activities are entertaining and help to demonstrate our appreciation for members of our SLU family, perhaps the most satisfy-ing element of Homecoming is found in the personal interaction between longtime friends. For Homecoming is one of the few times during the year in which generations of Billikens come back to campus to celebrate and commemorate their shared identity. Alumni reminisce about old times while also introducing their former classmates to their personal families. We at SLU show off our campus and introduce our current family of students, faculty and staff, who share their own thoughts and feelings about the SLU experience. Alumni often share their own success stories, but more importantly, their stories about fam-ily, friends and faith. They tell me how the philosophy, ethics and theological components they once grumbled about now serve them well in their everyday lives. Conversely, we let alumni know that SLU remains committed to informing and transform-ing our current students, who, in turn, will transform society in the spirit of the Gospels. I give assurances that although the nature of higher education has changed, SLU remains true to its Jesuit, Catholic heritage — just like it has for generations, all the way back to its found-ing in 1818. Yes, we truly see the spirit of Saint Louis University revealed and refreshed during our Homecoming festivities. It gives me great joy to hear about the ways in which members of the SLU community continue to make a difference for their families, for their communities, for their professions, for their world. Though it is only one weekend during the year, there’s undoubtedly an invisible bridge that links generations of Billiken alumni together. We can be reassured that SLU continues to succeed in preparing its graduates for a lifetime of service to humankind. It’s wonderful to see that SLU is indeed “where the heart is” in so many people’s lives. UNIVERSITAS Volume 30, No. 1 Editor Laura Geiser (A&S ’90, Grad ’92) Assistant Editor Chris Waldvogel Contributors Clayton Berry Jeff Fowler Photo Credits Steve Dolan, 3, 9, 30 Joe Finlay, 4 Kevin Lowder, 10 Dave Preston, 26 John Quinn, S.J., 20 James Visser, cover, 4, 12-15 Chris Waldvogel, 2, 3, 5 New Line Cinema, 18, 20-22 Design AKA Design Inc. Art Direction: Richie Murphy Design: Stacy Lanier UNIVERSITAS is published by Saint Louis University. Opinions expressed in UNIVERSITAS are those of the indi-vidual authors and not necessarily those of the University administra-tion. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publica-tion should indicate that fact. The editor reserves the right to edit all items. Please address all mail to UNIVERSITAS, DuBourg Hall 39, 221 N. Grand, St. Louis, MO 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, UNIVERSITAS. Postmaster: Send address changes to UNIVERSITAS, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html UNIVERSITAS is printed by Universal Printing Co. and mailed by Accurate Business Mailers Inc. Worldwide circulation: 109,611 © 2003, Saint Louis University. All rights reserved. On the Cover: The new Busch Student Center courtyard. For more photos of Busch Student Center, see page 12. IIN MEMORIIAM AALLUUMMNNII nnootteess 2 24 32 28 30 FALL 2003 6 Home-Court Advantage Take a peek at the plans for Saint Louis University’s proposed arena. 10 Remembering Father Ong A look at the life of one of SLU’s most noted scholars. 12 Center of Attention The renovated and expanded Busch Student Center is drawing raves. 16 Momentum The Campaign for Saint Louis University marks its first anniversary. 18 Lore of the Rings A SLU professor is one of the world’s foremost experts on J.R.R. Tolkien. C O N T E N T S 2 SLU named a ‘Best Buy’ again Saint Louis University is the nation’s top educa-tional buy among all Jesuit institutions according to U.S. News & World Report, which again recognized Saint Louis University as one of the country’s best values in high-er education. Overall, the magazine also ranked SLU among the top four Catholic universities in the country. In the publication’s “America’s Best Colleges 2004” issue, SLU is No. 41 on the best values list among all national doctoral universi-ties. This is the sixth consecu-tive year that U.S. News has highlighted the University as a leading educational value. SLU is the top Jesuit institu-tion on the best value list and the No. 2 Catholic school, second only to the University of Notre Dame. U.S. News determines best values by measuring academic quality with the net cost of atten-dance for a student who receives an average level of financial aid. U.S. News also named Saint Louis University among the top four Catholic institutions on its ranking of best national doctoral universities, a group that includes nearly 250 schools. SLU is No. 78 on the list, with only Notre Dame, Georgetown University and Boston College ranking higher. HOMELAND SECURITY: Hundreds of people attended the first town hall meeting on homeland security featuring U.S. Homeland Security Secretary Tom Ridge Oct. 7 at Saint Louis University. An interactive event with high audience participation, the forum included (from left) Frank Sesno, host of Worldtalk and former CNN anchor; Steve Rohleder, global chief executive for government, Accenture; St. Louis Mayor Francis Slay (Law ’80); Ridge; Dr. Karen Webb, chief medical officer for Saint Louis University Hospital; and Col. Tim Daniel, director for the Missouri Office of Homeland Security. University President Lawrence Biondi, S.J., gave the opening remarks. Sword award to honor Westfall Saint Louis University will give its highest honor to the late George R. “Buzz” Westfall (A&S ’68, Law ’69). SLU will recognize the late political leader with its Sword of Ignatius Loyola during the DuBourg Society Dinner Dec. 7. Mr. Westfall died Oct. 27. He was 59. One of the region’s most influential public figures of the last 20 years, Mr. Westfall was elected St. Louis County executive in 1990 and was re-elected three times. Noted for his bipartisanship and regional focus, his accomplish-ments included the establish-ment of a shelter for battered women and children. The Sword of Ignatius Loyola is named for the founder of the Society of Jesus. Symbolic of the Ignatian vision of service, sword recipients have given themselves to humankind for the greater glory of God. Louis; Keith F. Muccino, S.J., assistant professor of internal medicine and Catholic chap-lain at Georgetown University School of Medicine; and Robert L. Niehoff, S.J., vice president for budget and plan-ning at the University of San Francisco. New trustees join SLU board Three new trustees have joined the Saint Louis University board: L.B. Eckelkamp Jr., chairman of the board and CEO of the Bank of Washington (Mo.) and chair-man and president of Cardinal Bancorp and Cardinal Bancorp II, which owns the United Bank of Union and Citizens National Bank of Greater St. SLU JOINS A10 CONFERENCE Saint Louis University is joining the Atlantic 10 Conference. The Billikens will begin intercollegiate athletic competition in the Atlantic 10 during the 2005-06 academic year. The Atlantic 10 Conference is in its 28th year of NCAA Division I competition. The league’s members include Dayton, Duquesne, Fordham, George Washington, LaSalle, Massachusetts, Rhode Island, Richmond, St. Bonaventure, Saint Joseph’s, Temple and Xavier. Saint Louis University currently is a charter member of Conference USA. In early November, five C-USA member schools — Cincinnati, DePaul, Louisville, Marquette and USF — accepted invitations to join the Big East Conference. Five new schools — Central Florida, Marshall, Rice, SMU and Tulsa — filled C-USA’s vacant positions. For more details, visit www.slubillikens.com. Three new deans now on campus Dr. Ellen Harshman (Grad ’78, Law ’92) is the new dean of the John Cook School of Business. She succeeds the retiring Dr. Leroy Grossman, who was interim dean for one year. Harshman has served SLU in several leadership roles since 1972, including associate dean of the business school, director of the career planning and placement center and assis-tant to the vice president for student development. She also holds the rank of associate pro-fessor of management and most recently was SLU’s senior vice provost. Among her many responsibilities in this role, Harshman administered com- NEWS BRIEFS By The Numbers 4 National rank of Parks College of Engineering and Aviation’s aerospace engineering program, according to U.S. News and World Report. Overall, Parks’ undergraduate engineering pro-grams moved up three spots on the U.S. News list to No. 27. 498 Residents sponsored by SLU’s School of Medicine in 50 different residencies, subspecialty residencies and fellowships rotat-ing through eight affiliated teach-ing hospitals and 18 affiliated health care institutions. 8,742 Phone pledges made dur-ing fiscal year 2003 for a total for 1,067,000indonationstoSaintLouisUniversity.Thisisa23percentincreaseoverlastyearandthefirsttimethatmorethan1,067,000 in donations to Saint Louis University. This is a 23 per-cent increase over last year and the first time that more than 1 mil-lion has been raised through phoning. In September, SLU sponsored a two-evening gala event called “Denim & Diamonds” to benefit public education, research and treatment of liver disease. On Sept. 12, Willie Nelson headlined “Denim,” a concert to benefit the SLU Liver Center and the Julia Spears Foundation for Liver Disease. On Sept. 13, “Diamonds” fea-tured country music artist Naomi Judd, who spoke at a black-tie dinner to benefit SLU’s Liver Center. … Dr. Robert B. Belshe, Adorjan professor of infectious diseases and director of the Center for Vaccine Development, received the Clinical Virology Award for 2003 from the Pan American Society for Clinical Virology. … Sandra H. Johnson (A&S ’73), the Tenet Endowed Chair in Health Law and Ethics is one of four winners of the 2003 Pellegrino Medal for contribu-tions to health care ethics. … Dr. Marla Berg-Weger, pro-fessor and director of field service education for the School for Social Service since 1995, has been named associate provost. … Maria Whitehead, a member of Wake Forest’s 2002 NCAA Division I field hockey champi-onship team, is SLU’s new head field hockey coach. The appoint-ment is her first head coaching position. … Dr. Seung H. Kim, professor of international business and director of the Boeing Institute of International Business, has been appointed to serve on the Presidential Advisory Council for the Peaceful Reunification of the Republic of Korea. RESEARCH PLANS: Preliminary plans are under way for the design and site selection for a new research center at the Saint Louis University Health Sciences Center, part of an 80millioninvestmentinnewandrenovatedresearchspace.RaisingmoneyforthebuildingispartoftheUniversitys80 million investment in new and renovated research space. Raising money for the building is part of the University’s 300 million “Campaign for Saint Louis University: Where Knowledge Touches Lives.” pliance with the University’s accrediting agencies, served as a liaison with state-wide edu-cational agencies and oversaw the libraries, Reinert Center for Teaching Excellence and office of institutional study. Harshman has earned numer-ous honors during her SLU career and was named SLU’s Woman of the Year in 1981. Dr. Charlotte Royeen, a national leader in her field of occupational therapy, is the new dean of the Doisy School of Allied Health Professions. Royeen most recently served as associate dean for research at Creighton’s School of Pharmacy and Allied Health Professions and professor of occupational therapy. Prior to that, she was the founding chair and professor of occupa-tional therapy at Shenandoah University in Winchester, Va., and worked for several years for the U.S. Department of Education’s Office of Special Education Programs. Royeen holds a doctorate from Virginia Polytechnic Institute and State University in Blacksburg, Va., and a master’s degree in occu-pational therapy from Washington University School of Medicine. At the confer-ence of the American Occupational Therapy Association, Royeen received the 2002 Eleanor Clarke Slagle Lectureship Award, which is the highest scholarly achieve-ment bestowed in occupational therapy. Dr. Bjong Wolf Yeigh joined the Saint Louis University community July 1 as the dean for Parks College of Engineering and Aviation. He came to SLU from Yale University, where he was assis-tant provost of science and technology since 1999. He succeeds Dr. Charles Kirkpatrick, who was dean of Parks College for nine years and is on the department of chemistry faculty. Yeigh received a bachelor’s degree in engineering science from Dartmouth College, a master’s degree in mechanical engi-neering from Stanford and a doctorate in civil engineering and operations research from Princeton. A former tactical air intelligence officer assigned to Fighter Squadron 74, Yeigh served in the U.S. Navy dur-ing the Gulf War and for a total of eight years in active and reserve duties, leaving with a rank of lieutenant. Yeigh Royeen Harshman New technology VP on board Ellen Watson is Saint Louis University’s new vice president for information technology services. Although Watson may be new to SLU, she is familiar with the Jesuit mission. Before coming to SLU, she was the vice president of information service at Loyola University Chicago, a post she had held since 1999. Watson boasts 19 years of experience in her field, hav-ing served as associate vice president for information ser-vices and dean of library ser-vices at Indiana State University for four years and associate provost for informa-tion resources and technology at Bradley University for two years. She received her bach-elor’s degree from Wellesley College and her master’s from the University of Maryland. Drabble wins Literary Award Saint Louis University Library Associates pre-sented English author Margaret Drabble with the 2003 Saint Louis Literary Award at a ceremony Oct. 21. Drabble, a novelist, biog-rapher, critic and short story writer, is the author of The Seven Sisters, The Peppered Moth, The Witch of Exmoor and The Millstone. She is also editor of The Oxford Companion to English Literature. Drabble joins a dis-tinguished group of authors honored with this award dur-ing the past 36 years. Recipients include such luminaries as Arthur Miller, Joyce Carol Oates and Seamus Heaney. Last year’s winner was Joan Didion. Biodefense research brings schools together Anew research center based in St. Louis will play a major role in protecting the American public against bioterrorism and emerging infectious diseases. Washington University School of Medicine and Saint Louis University School of Medicine will be part of a multi-institutional Midwest Regional Center for Excellence in Biodefense and Emerging Infectious Diseases Research (MRCE). The cen-ter will be funded by a five-year, 35 million grant from the National Institute of Allergy and Infectious Diseases. The founding members of the MRCE also include Case Western Reserve University, the University of Missouri- Columbia and the Midwest Research Institute of Kansas City. The new center will concentrate on expanding cur-rent research efforts in biode-fense. For example, the team’s initial research effort will focus on poxvirus infections, which include diseases such as small-pox. The ultimate goals are to improve the safety of vaccines and to develop new therapies. Kavanaugh wins press award Saint Louis University phi-losophy professor and mag-azine columnist John Kavanaugh, S.J., (A&S ’65, Grad ’66, ’71) received top honors from the National Catholic Press Association. His “Ethics Notebook,” which regularly appears in America magazine, earned the Best Regular Column Award from Kavanaugh MIXING IT UP: What’s cooking in the department of nutrition and dietetics in the Doisy School of Allied Health Professions? Mark E. Miller, a certified executive chef, shown here supervising students Christina Bologna (left) and Diana Kingston, has joined the Saint Louis University faculty and is teaching future dietitians how healthy foods can be prepared to taste great. Miller, most recently a chef at Westborough Country Club, is sold on the University’s new, one-of-a-kind degree program that prepares students to become registered dietitians while they receive training for their culinary arts credential. “Our degree is perfect for stu-dents who want to work as personal chefs, among other spe-cializations,” Miller said. International HIV trial led by SLU Saint Louis University is leading an international vaccine trial to study a promising HIV prevention vaccine in humans. The trial is being conducted through the HIV Vaccine Trials Network (HVTN) of the National Institutes of Health. This is the first HVTN trial to be conducted simultane-ously in the United States and abroad — in St. Louis, Boston (through Harvard University) and Gaborone, Botswana — and it signifies a dedication to transcending borders in the fight against HIV. This vaccine has never been tested in humans. The trial is looking at the safety and immune response of an experimental HIV vaccine the association, which repre-sents 640 publications with a combined circulation of nearly 27 million in the United States and Canada. In honoring him, the National Catholic Press Association said: “Father Kavanaugh examines public issues through a moral lens and discusses them thoughtfully and powerfully.” 4 The December 1963 issue of Saint Louis University Magazine featured a cover photo of the new Griesedieck Memorial Hall, which was dedicat-ed Nov. 30, 1963. A news item mentioned that fund raising for Busch Memorial Center was under way — .1.5 mil-lion had been raised, and a 1.5millionloanhadbeensecured.Itwasestimatedthatthetotalcostofconstructionwouldbe1.5 mil-lion loan had been secured. It was estimated that the total cost of con-struction would be 3.25 million. The issue also highlighted the Midwest Assembly on Outer Space, a conference co-sponsored by SLU and held that September. The assembly brought together a cross section of leaders in education, gov-ernment, labor, business, industry, law, medicine, military and commu-nications from a 14-state area to consider the topic, “Outer Space: Prospects for Man and Society.” Participants included James E. Webb, the head of NASA, and U.S. Sen. Stuart Symington of Missouri. Another article featured an alum-nus, Robert Burns (Parks ’59), who was the first Missourian to join the Peace Corps. Burns was a land irri-gation specialist in Pakistan. Quotable UTAS: “It would be tragic if we were able to pinpoint rockets in space but unable to deter-mine where we were going as human beings.” — Charles A. Sheehan, Missouri state representa-tive and speaker at the Midwest Assembly on Outer Space Sign of the times: It was reported that tuition for the 1964-65 school year for full-time undergraduates and law students would be 575persemester,whichwasanincreaseof575 per semester, which was an increase of 100 over 1963-64 rates. School of Medicine students were slated to pay $700 per semester. SLU nabs C-USA GPA award again Conference USA has named Saint Louis University as the recipient of the Institutional Excellence Award for the eighth consecutive year. The award is given to the member school with the highest SLU listed as ‘Best Place to Work’ For the second time since 2000, Saint Louis University has made the St. Louis Business Journal’s “Best Places to Work” list. This year, SLU was honored in the “Best Practice” category — the only institution so recognized — for the development of Hometown SLU, which is designed to spur development near the St. Louis campus while assisting SLU employees looking to purchase a home in certain areas near campus. Since Hometown SLU was unveiled Feb. 5, 19 people have applied to the program and been approved. Full-time, eligible employees may receive f

    Universitas: the magazine of Saint Louis University

    No full text
    Fall 2006 issue of Universitas: the magazine of Saint Louis UniversityCatching up with SLU’s Madrid Campus page 8 Not Your Typical College Cafeteria page 14 Shimmy Gray-Miller: Off Court, On the Record page 18 E d i t o r Laura Geiser (A&S ’90, Grad ’92) C o n t r i b u t o r s Jeff Fowler Nancy Solomon “ O n C a m p u s ” n e w s s t o r i e s University Communications Medical Center Media Relations Billiken Media Relations De s i g n Art Direction: Matthew Krob Universitas is published by Saint Louis University. Opin-ions expressed in Universitas are those of the individual authors and not necessarily those of the University admin-istration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 221 N. Grand, St. Louis, Mo. 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, Universitas. Postmaster: Send address changes to Universitas, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html Universitas is printed by Universal Printing Co. and mailed by Specialty Mailing. Worldwide circulation: 111,720 © 2006, Saint Louis University All rights reserved. Volume 3 3 , I ssue 1 I was having dinner in Beirut with the presi-dent of Notre Dame University of Lebanon on July 12 when he got the call: Hezbollah militants had just abducted two Israeli soldiers. At that point, I had no idea just how harrowing the next week would be. When I left for Lebanon just two days ear-lier to deliver Notre Dame’s commencement ad-dress, I had no indication a crisis was brewing. But by July 13 all hell broke loose. From my hotel in northern Beirut, I heard Israeli jets at-tacking the Hezbollah section of the city. From my balcony I could see clouds of black smoke rise into the air, and at night I could see fires on the horizon. When the airport and major roads were bombed, I began to wonder when — if — I would get back to St. Louis. For the most part, I felt safe. Because the ho-tel was in the so-called Christian area of greater Beirut, we were told it was unlikely to be a tar-get. Even so, the fighting grew more intense ev-ery day. Occasional black-outs and media warnings to stay in the hotel kept me on edge. Even more unnerving, days passed with no word from the staff at the U.S. embassy, even though I had taken care to register my pres-ence with them several times. Literally waiting by the phone in my hotel room, I began to feel like a hostage. Finally — at 3 a.m. on July 19 — Saint Louis University’s general counsel called to say he had received word from the State Department that I would be leaving on the cruise ship the Orient Queen that day and would be permitted only one 30-pound bag. I rounded up my essential documents, left my other luggage behind and headed to the des-ignated staging area. Waiting in line, I heard bombs exploding, sounding like thunderclaps reverberating in every direction. After showing my passport to the embassy staff, I boarded a bus to the Beirut seaport. I joined about 200 men, women and children gathered there, all of us anxious to be cleared to board ship. Bombs were dropping just a few miles away; it was the closest I had been to the fighting. We finally left port at 4 p.m. with an Ameri-can warship, the U.S.S. Gonzalez, following us in a corridor only half a mile wide. The Gonza-lez accompanied us all the way to Cyprus. We arrived just after midnight, but a ship bearing French national evacuees from Beirut had ar-rived before us, so we had to stay on the Orient Queen for three more hours. Tension was high. Everyone was anxious to get off the ship, find a place to stay and begin making their necessary travel arrangements. Some people fainted; some got angry. There was some pushing and shoving and even a fistfight. When more than 1,000 of us were told we could disembark, the exodus process became chaotic. Eventually, I got off the ship and to a taxi that took me to a hotel about 50 miles away. I was able to catch a chartered plane the next evening, and I finally arrived in St. Louis at 1 p.m. July 21. It had taken me about 12 hours to get from the United States to Lebanon by plane. It took me nearly 52 hours — by bus, ship, taxi and plane — to get home. Although I was relieved to be out of war-torn Lebanon, I must confess that my experi-ences there were among the most memorable of my life. I’m not saying I’d willingly do it again, but I am genuinely grateful that I had an opportunity to get to know and appre-ciate the Lebanese people and see how resiliently they handled this crisis. I also am genuinely grateful for the sober-ing moments I spent in my hotel room thinking about my life, my relationships and my work at SLU. I know I have a reputation for being some-what tough and business-minded at times. But I came to realize how fortunate I am — with the help of my God — that so many people were thinking of and praying for me. Even several months later, I continue to re-flect on my life-changing experiences in Leba-non. I am not a politician, but I know that what’s most important is to settle this conflict for the long term. If not, the Lebanese and Is-raeli people — especially the children — will continue to suffer. And unlike me, they won’t get a call at three in the morning to board the Orient Queen and get out. — Lawrence Biondi, S.J. A version of this essay appeared July 30 on the Com-mentary page of the St. Louis Post-Dispatch. President’s Message photo by Jim Visser U N I V E R S I T A S F A L L 2 0 0 6 F E AT U R E S Universidad de San Luis SLU’s Madrid campus offers students the world. By Laura Geiser A landmark campus gateway framed by fall foliage. Photo by Kevin Lowder DE PA R TMEN T S 2 On Campus Arena groundbreaking Update on SLU’s national rankings Lincoln exhibit brings visitors to campus 6 Billiken News Soccer stadium readies for the College Cup Forward pass marks its 100th 7 Campaign Update Campaign already exceeds 300milliongoalFundforExcellence22ClassNotesCatchupwithclassmates29InMemoriamRememberingthosemembersoftheSLUcommunitywhorecentlydied30AlumniEventsFindSLUalumniactivitieswhereveryoulive32PerspectiveAnalumnuswhorecentlyjoinedtheJesuitsshareshisexperiences.33TheLastWordLetterstotheeditor1418RecipeforFreshGatheringsSLUsuniquecafeteriaintheDoisyCollegeofHealthScienceshasalltheingredientsforsuccess.ByNancySolomonShimmyGetupcloseandpersonalwithSLUswomensbasketballcoach,ShimmyGrayMiller.ByLauraGeiserPhotobyAngelAlvarezUNIVERSITASwww.slu.eduUNIVERSITASFALL2006TowatchtheprogressoftheArenaconstruction,visitthewebcamlinkatarena.slu.eduSaintLouisUniversitybrokegroundonitsnew300 million goal Fund for Excellence 22 Class Notes Catch up with classmates 29 In Memoriam Remembering those members of the SLU community who recently died 30 Alumni Events Find SLU alumni activities wherever you live 32 Perspective An alumnus who recently joined the Jesuits shares his experiences. 33 The Last Word Letters to the editor 14 18 Recipe for Fresh Gatherings SLU’s unique cafeteria in the Doisy College of Health Sciences has all the ingredients for success. By Nancy Solomon Shimmy Get up close and personal with SLU’s women’s basketball coach, Shimmy Gray-Miller. By Laura Geiser Photo by Angel Alvarez U N I V E R S I T A S w w w . s l u . e d u U N I V E R S I T A S F A L L 2 0 0 6 To watch the progress of the Arena construction, visit the webcam link at arena.slu.edu Saint Louis University broke ground on its new 80.5 million multipurpose Arena Aug. 28 at the Arena site near Compton and Laclede avenues. University officials, coaches and student athletes as well as St. Louis dignitaries were in attendance to celebrate the new facility, which includes a 10,600-seat Arena, a practice facil-ity, athletics offices, locker rooms and training facilities. “It has taken us a long time to get here,” said University President Lawrence Biondi, S.J. “While I am not known as the most patient man in St. Louis, I never lost faith that we would get to this day. And, thankfully, there were many others who believed as I did.” The new Arena will be home to Billikens men’s and women’s bas-ketball and will host a variety of other events such as concerts, confer-ences, trade shows and commencements. It is expected to bring more than 400,000 people to Midtown St. Louis each year. St. Louis-based Clayco will build the Arena, with an expected opening in March 2008. “There are few institutions in St. Louis that have done more to enhance life in the city than Saint Louis University,” said Barry H. Beracha, chairman of the SLU board of trustees. “I ask our friends from throughout the region to help us complete the fundraising for this wonderful facility.” Arena donors were recognized at the event, which also brought out hundreds of faculty, staff, students and Billiken fans to witness the beginning of the long-awaited project. “This is one of the greatest days in Billiken athletics history, and I’m overjoyed to be here and be part of it,” said director of athletics Cheryl L. Levick. “This building is a product of a tremendous grass roots fundraising effort because this is a privately funded facility that did not tap into student fees or tuition dol-lars. No matter the size of the gift, everyone involved in contributing to this building has the right to be extremely proud today.” “I want to thank Father Biondi and the board of trustees for giving our program the opportunity to compete on a national level,” said men’s basketball head coach Brad Soder-berg. “When we bring recruits to campus, they now will know that we are serious about competing with the best programs in the country.” “The University administration has done its job in bringing this building to life,” said women’s basketball head coach Shimmy Gray- Miller. “Now I promise that I will do my job, my staff will do its job, and our student-athletes will do their job to produce winning basketball.” The Arena complex will be built on University-owned property on the eastern end of campus and will be visible from Interstate 64/ Highway 40. It will be funded through fundraising, 8millioninTIFfundingandthroughbonds,whichwillbepaidoffwithrevenuesfromtheArena.InAugust,SLUannouncedthattheJackTaylorFamilyandU.S.Bankeachdonated8 million in TIF funding and through bonds, which will be paid off with revenues from the Arena. In August, SLU announced that the Jack Taylor Family and U.S. Bank each donated 1 million for the Arena, moving the University closer to the project fundraising goal. For others who would like to make a gift, there still is time to be part of the Arena project. To make a donation online, go to arena.slu. edu or call (314) 977-2499. — JF Arena construction under way; opening planned for March 2008 Top: The official groundbreakers: (from left) Dan Mitchell, partner, Mackey Mitchell Associates; L.B. Eckelkamp, SLU trustee; Joe Imbs, president, St. Louis market, U.S. Bank; Thomas Brouster Sr., SLU trustee; Soderberg; Levick; Dr. Joe Weixlmann, SLU provost; Biondi; St. Louis Mayor Francis Slay; Kathleen Brady, SLU vice president for facilities management and civic affairs; Gray-Miller; 19th Ward Alderman Michael McMillan; Beracha, Vince Schoemehl, president, Grand Center; Bob Clark, Clayco chairman and chief executive officer; and Evan Krauss, president, SLU Student Government Association. Middle: St. Louis Mayor Francis Slay (Law ’80) addresses the crowd. Above: Gray-Miller, Biondi, Soderberg and Levick throw the dirt. U.S.News keeps SLU on its ‘Best Buy’ list For the ninth consecutive year, U.S.News & World Report has recognized Saint Louis University as one of the nation’s best values in higher education. In its special “America’s Best Colleges” issue, U.S. News lists SLU among the top 50 national, doctoral universities on its coveted “Great Schools, Great Prices” list. SLU joins Georgetown and Boston College among the Catholic institutions on the best values list. In addition, SLU climbed to No. 77 on U.S. News’ rankings of the nearly 250 national universities in the country — a list topped by Princeton and Harvard. It’s the third straight year that SLU has risen in these rankings. Once again, SLU ranked among the top five Catholic institutions in the country on this overall list. Parks College of Engineering, Aviation and Technology’s aerospace engineering program was ranked No. 5, and undergraduate engineering programs overall were ranked 29th among engineering schools whose highest degree is a master’s. SLU’s undergraduate business programs in the John Cook School of Business again were ranked among the top 100 of the nation. Princeton Review also honors SLU The Princeton Review has named Saint Louis University one of the top institutions in the country for undergraduate education. SLU also was listed as one of the best universities in the Midwest in the 2007 edition of Princeton Review’s annual book, The Best 361 Colleges. Only about 15 percent of four-year colleges in America and two Canadian colleges made the publication. The book does not rank the colleges 1 to 361 in any single category. The book’s rankings are based on a survey of 110,000 students attending the colleges in the book. In the survey, SLU students spoke highly of the University’s business, pre-med and pre-law programs as well as unique programs in aviation and nutrition. Survey respondents also noted that SLU students are friendly and that the University offers a great library. Doisy College of health sciences adds new programs Already experiencing an enroll-ment boom, Saint Louis Uni-versity’s Edward and Margaret Doisy College of Health Sciences an-ticipates even more growth in the future as it prepares to assume responsibility for three programs that will be discon-tinued at the Barnes-Jewish College of Nursing and Allied Health in St. Louis next year. Dr. Charlotte Royeen, dean of Doisy College, said next fall SLU plans to offer the following new options for SLU stu-dents, pending approval by the board of trustees: A new bachelor of science pro-gram in radiation therapy; a new bache-lor of science program in cytotechnology; and a proposed expansion of the graduate program in the department of nutrition and dietetics. SLU and Barnes-Jewish officials are working to make sure that the transition for both students and employees goes smoothly. Some faculty at Barnes-Jew-ish College will join the faculty of SLU’s Doisy College, and students enrolled in SLU programs still will have the option of participating in clinical training on-site at Barnes-Jewish Hospital. SLU honors Maronite patriarch Saint Louis University bestowed its highest honor, the Sword of Ignatius Loyola, on the patriarch of the Maronite Catholic Church June 30. His Beatitude and Eminence Nasrallah Peter Cardinal Sfeir, Patriarch of Antioch and All the East, visited St. Louis as part of a pastoral visit to America. He was the most significant religious figure to visit St. Louis since Pope John Paul II in 1999, and his visit marked only the fourth time a Maronite patriarch has journeyed to the United States. Sfeir also received an honorary doctorate of laws from Saint Louis University. En route to the award ceremony, University President Lawrence Biondi, S.J., (right) shares a light moment with Maronite Bishop Robert J. Shaheen (far left) and Cardinal Sfeir (second from left). Photos by Steve Dolan Photo by Kevin Lowder U N I V E R S I T A S w w w . s l u . e d u U N I V E R S I T A S F A L L 2 0 0 6 Gilsinan to accept professorship, step down as dean Saint Louis University’s College of Public Service has reached a new milestone: the establishment of its first named professorship. Civic leader E. Desmond “Des” Lee provided funding to support the E. Desmond Lee Professor-ship in Collaborative Regional Education. Dr. James Gilsinan, dean of the Col-lege of Public Service, has been named the first holder of the professorship. Be-cause the professorship requires teaching, research and service, Gilsinan will step down as dean and rejoin the faculty on a full-time basis at the end of December. The honor recognizes Gilsinan’s decades of service to St. Louis area schools, local governments and non-profit organiza-tions. As a Des Lee Professor, Gilsinan will join scholars from Washington Uni-versity in St. Louis and the University of Missouri-St. Louis in researching ways to help schools and communities improve the lives of young people. Michael Frayn wins Literary Award The Saint Louis University Library Associates will pres-ent the Saint Louis Literary Award to Tony Award-winning playwright, novelist and translator Michael Frayn at 5:30 p.m. Friday, Nov. 10, in the Anheuser-Busch Auditorium of SLU’s John and Lucy Cook Hall. The pro-gram is free and open to the public. Frayn is the author of several plays, including Noises Off, Democracy and Copenhagen, which won the 2000 Tony Award for Best Play. He has written several novels including The Tin Men, The Russian Interpreter and Spies. He also has translated several plays by Chekov and Tolstoy from Russian. In receiving the award, Frayn joins a select group of previous recipients, including Robert Penn Warren, Arthur Miller and Tom Wolfe. The award has been presented annually since 1967. Researchers tackle mold removal Armed with a $408,000 grant from the Department of Housing and Urban Development, a team from Saint Louis University School of Public Health hopes to create universal stan-dards for getting rid of mold in homes and buildings. Dr. Anu Dixit, assistant profes-sor of environmental and occupational health and principal investigator, said that the team will review existing, inconsistent guidelines for mold removal from homes and buildings by surveying about 400 mold assessment and remediation profes-sionals. The team will then use the re-sponses to develop a single comprehensive, scientifically sound plan for homeowners and mold remediation experts to follow. “The timing couldn’t be better for Hur-ricane Katrina and Rita victims, some of whom are still battling mold problems in their homes and businesses,” Dixit said. News Briefs Saint Louis University has appointed Karla Gable director of undergraduate admission. She most recently was assistant vice president of business development at the Missouri Higher Education Loan Authority (MOHELA), where she oversaw all marketing and public relations efforts. Prior to joining MOHELA in 2000, Gable was associate dean of enrollment and director of financial aid at Westminster College in Fulton, Mo. Dr. Neil Seitz has stepped down as interim dean of Parks College of Engineering, Aviation and Technology. Dr. Manoj Patankar (Parks ’92), associate professor and chairman of aviation science, has been named interim dean. A committee has been formed to begin the search for a new dean for Parks. Covering more than three-dozen specialties, 112 SLUCare doctors have been selected for St. Louis Magazine’s 2006 “Best Doctors” list. The list is based on the annual “Best Doctors in America” database, which considers more than one million peer evaluations to create a directory of approximately 30,000 doctors. A total of 104 SLUCare physicians were chosen for last year’s list. Dr. Teri Murray (Nurs ’79, Grad ’93, ’97) has been named the new director of the School of Nursing in the Doisy College of Health Sciences. Murray, previously the associate director, succeeds interim director Dr. Margie Edel. Murray, also an associate professor of nursing, recently was named to the prestigious 2006 Robert Wood Johnson Executive Nurse Fellows Program, which provides individual leadership development for nurses who aspire to lead and shape the U.S. health care system. She is also the president of the Missouri State Board of Nursing. Dr. Jennifer Kohler (A&S ’93, Grad ’97, ’99) is the new director of the School for Professional Studies. She is the first director of the school in a new position created as a result of the recent merger with the College of Public Service. Kohler previously served as director of organizational studies, interim associate dean and associate dean in the School for Professional Studies. The National Defense Transportation Association has named Saint Louis University’s Dr. Ik- Whan Kwon (Grad ’90), professor of decision sciences and management information systems, as the 2006 recipient of the NDTA Educator Distinguished Service Award. Kwon is recognized internationally for his specialization in supply chain design and management and is director of the Consortium for Supply Chain Management Studies at the John Cook School of Business. Campus goes wireless This summer, Saint Louis Uni-versity’s information technology staffers and subcontractors pulled 150,000 feet of wire throughout campus to make SLU completely wireless. Now the University’s wireless network includes the entire campus — including residence halls and academic buildings. Campus Kitchen marks its fifth anniversary and serves its 125,000th meal In September, Saint Louis University’s Campus Kitchen cel-ebrated its fifth anniversary and served its 125,000th meal. In 2001, SLU served as the pilot school for the Campus Kitchens Project, a growing network of Campus Kitchens that are hosted by universities across the country. Each Campus Kitchen shares dining hall kitchen space with host universities; partners with campus dining to recycle safe, us-able food that would normally go to waste; and mobilizes college students and community volunteers to make and deliver meals to the community. Each month, SLU Campus Kitchen volunteers deliver more than 2,000 meals and snacks to local residents, community cen-ters and after-school programs. Volunteers prepare meals in an on-campus cafeteria and then deliver them to individual families and group service centers. SLU’s success has paved the way for the Campus Kitchens Proj-ect to schedule three new site openings this fall, bringing the net-work to 10 Campus Kitchens nationwide. Sobrino returns to SLU after 15 years One of Saint Louis University’s most famous alumni was back on campus in September for the first time in 15 years. SLU’s Great Is-sues Committee welcomed Jon Sobrino, S.J. (A&S ’62, Grad ’65), who discussed “Being Christian in a World of Poor and Victims.” Sobrino’s contributions to theology have been recognized with nu-merous awards, includin

    Universitas: the magazine of Saint Louis University

    No full text
    Fall 2008 issue of Universitas: the magazine of Saint Louis UniversityINSIDE: A Q&A with John Kavanaugh, S.J. page 12 Emergency Preparedness page 16 First Class of Presidential Scholars page 19 16 2 Volume 35, Issue 1 Editor Laura Geiser (A&S ’90, Grad ’92) Contributors Clayton Berry David Chilenski (Cook ’98) Marie Dilg (Grad SW ’94) Nick Sargent “On Campus” news stories University Communications Medical Center Communications Billiken Media Relations Design Art Direction: Matt Krob Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 221 N. Grand, St. Louis, Mo. 63103. We accept e-mail at utas@ slu.edu and fax submissions at (314) 977-2249. Address fax submissions to Editor, Universitas. Postmaster: Send address changes to Universitas, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html Universitas is printed by Universal Printing Co. and mailed by Specialty Mailing. Worldwide circulation: 118,600 © 2008, Saint Louis University All rights reserved. FALL 2004 WINTER 2005 Twenty years ago, I had just begun to settle in for my first year here at Saint Louis University when I challenged our board of trustees and administration team to create new ways for us to fulfill our mission of forming women and men for others. We knew that the Saint Louis University educa-tional experience was a unique opportunity, and we were striving to find a new way to attract students who not only were high-caliber academic scholars but also had the potential to become the type of leaders needed to improve our communities. Due to the generosity of alumni and SLU supporters, we were able to establish the Presi-dential Scholars program, which back in 1988, awarded the first 10 recipients with full schol-arships to Saint Louis University. In this issue of Universitas you will see how that investment continues to pay dividends for these 10 men and women and for the communities in which they live. I am blessed to have been at SLU long enough not only to witness the growth of this first class of Presidential Scholars during their years at SLU, but also now to see how they have grown and fulfilled the promise we saw in them two decades ago. Starting on page 19, you can read about this “first-class” group — an emergency room physician, owner of a social service agency, corporate lawyer, business analyst, piano teacher, researcher, pediatrician, manager for a home health care company and two alumnae serving their families as full-time mothers. Although they have settled on careers and homes that literally are all over the map, the members of the initial class of Presidential Scholars — much like the more than 300 Presidential Scholars who have followed them — show a commitment to service to others as well as an appreciation for the opportunities they received here at SLU. Their continued success is one of the best endorsements for the next generation of students who apply to Saint Louis University. And that’s one of the most important ways our original scholars are returning the invest-ment many SLU alumni and supporters made in them 20 years ago. We have great faculty, staff, researchers and alumni at Saint Louis University, but to keep SLU a great university, we need to continue to attract great students. All of you already are doing a wonderful job promoting Saint Louis University as you achieve success in your professional, personal and service lives. But I ask you to join your alma mater’s efforts to attract even more of tomorrow’s leaders to SLU. During the last academic year, SLU’s total enrollment increased 3 percent, and our goal is to continue to provide more opportunities for students who are eager to study at SLU. Even outside of St. Louis, many of you will see in movie theaters and hear on the radio a new SLU recruitment campaign, that encourages students to “Be a Billiken.” Using our Univer-sity’s unique mascot, the campaign highlights SLU’s equally unique attributes, which sepa-rate SLU from other top national schools. But your help, whether setting up one-on-one meetings with prospective students in your city or joining SLU recruiters at a college fair in your area, can make the difference in whether a student seriously considers SLU. If you’re interested in lending some of your valu-able time to the SLU recruitment cause, please contact our alumni relations office at alumni@ slu.edu for more information. I hope you enjoy reading about our 20th anniversary class of Presidential Scholars as much as I have enjoyed catching up with these 10 alumni. Lawrence Biondi, S.J., President SLU’s Presidential Scholarship celebrates its 20th anniversary. Photo by Jim Visser { president’s message } { contents } 8 | The Billiken: From Fad to Icon Learn how the Billiken came to be and how he came to SLU in this article celebrating the unique mascot’s 100 years. — By Nick Sargent 12 | Life, Hope and Homilies Philosophy professor John Kavanaugh, S.J., has been raising tough questions for more than 30 years. Now he gives some answers. — By Laura Geiser 16 | In Case of Emergency How well is SLU prepared for a crisis? A new emergency preparedness team is making sure the University is ready for anything. — By Clayton Berry 19 | Primary Scholars SLU’s inaugural class of Presidential Scholars arrived on campus 20 years ago. Find out where these 10 alumni are today. — By Marie Dilg 2 | On Campus Homecoming marks the Billiken’s birthday • New rankings released • Avian flu research • Heritage Hall • Art exhibits • Convocation 6 | Billiken News Basketball schedules • Trost on all- NCAA team • Volleyball wins big 7 | Advancement News A conversation with David Suwalsky, S.J., director of SLU’s museums and galleries. 24 | class notes Catch up with classmates. 28 | In Memoriam Remembering those members of the SLU community who recently died. 30 | alumni events Find SLU alumni activities wherever you live. 32 | Perspective A recent alumnus discusses the criminal justice system. 33 | the last word Letters to the editor. 8 19 12 features depar tments 6 2 U NI V E R S I T A S w w w. s l u . e d u U N I V E R S I T A S F A L L 2 0 0 8 3 { on campus } To celebrate the Billiken’s 100th year, the University threw two birthday celebrations to coincide with Homecoming and Family Weekend, which drew thousands of graduates and parents to campus Sept. 26-28. In all, more than 2,500 alumni and friends and 1,200 par-ents and family members made their way to SLU’s campus. The schedule of events included class reunions, jazz socials, campus tours and a St. Louis Cardinals baseball game. The birthday celebration kicked off in the Family Fun Area on Saturday, where alumni, parents and students turned out to make birthday hats, enjoy birthday-themed activities and eat cupcakes. The Billiken had only one wish for his birthday party: that all of his friends bring new children’s books, later donated to a special program at SSM Cardinal Glennon Children’s Medical Center. Almost 200 books were collected. The birthday celebration continued that night, as the men’s soccer team won its game against in-state rival Mis-souri State University by a 3-0 margin, with almost 5,800 in attendance. It was the second largest crowd in Hermann Stadium history. During halftime, the stadium lights dropped, and a three-tier cake was brought onto the field. The capacity crowd sang “Happy Birthday” to the Billiken. As soon as the song ended, a fireworks display erupted over the stadium. Homecoming Weekend also featured tours of the new Chaifetz Arena, the annual golf cart parade, a barbecue, Mass, brunch and a concert. “With wonderful events and spectacular weather, we really celebrated the Billiken’s birthday in style, and we are already looking forward to next year,” said Meg Connolly (A&S ’90, Grad ’92), associate vice president for alumni relations and annual giving. The 2009 Homecoming Weekend is scheduled for Sept. 25- 27. Call the office of alumni relations at (314) 977-2250 to help with reunion planning. Homecoming celebrates 100 years of the Billiken Scenes from this year’s homecoming This summer, two national publications recognized Saint Louis University as one of the best schools in the country for under-graduate education. U.S. News & World Report’s “America’s Best Colleges” ranks SLU 80th out of more than 260 national universities in the United States. The ranking placed SLU among the top five Jesuit universities in the country for the sixth consecutive year. U.S. News also gave high marks to the University’s undergrad-uate engineering and business programs. The Princeton Review’s 2009 edition of The Best 368 Colleges places SLU in the top 15 percent of America’s 2,500 four-year colleges. Listings in book are based on institutional data, school visits and feedback from students, independent college coun-selors and parents. However schools are chosen primarily for their outstanding academics. SLU earns U.S. News, Princeton Review honors Researchers study avian flu Saint Louis University School of Medicine has begun one of the larg-est avian flu clinical trials in the United States to test a new vaccine approach to prevent the disease. The study tests whether an injection of an FDA-approved avian flu vaccine created in 2004 can prime the body’s immune system so a second shot of a different avian flu vaccine can protect against avian flu infection. Public health experts are concerned that the avian flu could become the next influenza pandemic because bird viruses have started previous outbreaks. The study will examine the vigor of the body’s antibody response and the safety of the vaccines. SLU is the lead site of the research, which is sponsored by the National In-stitute of Allergy and Infectious Diseases, part of the National Institutes of Health, and will include up to five study sites. SLU named a great place to work In its “2008 Great Colleges to Work For” issue, The Chronicle of Higher Education recognized Saint Louis University as one of the best universities to work for in the nation. SLU was one of five institutions of higher education with 2,500 or more employees recognized in the following categories: Teaching Environment: Faculty members say the institution recognizes innova-tive and high-quali-ty teaching. Tenure Clarity and Process: Requirements for tenure are clear, faculty members say. Housing Assistance Programs: The “Hometown SLU” program provides forgiv-able loans toward homes purchased in neighborhoods near the University. 403(b) or 401(k): Saint Louis University offers an award-winning retirement plan. New endowed chair benefits ophthalmolo g y Dr. Anwar Shah, a former SLU faculty member, has established an endowed chair in ophthalmology. Shah began his relationship with SLU as an intern and resident in ophthal-mology, after coming to the United States from Pakistan as a Fulbright Scholar in 1955. After completing fellowships at Washington University in St. Louis and Harvard Medical School, Shah became director of retina services in SLU’s department of ophthalmology. He was a member of the SLU faculty for years, training numerous ophthalmology residents. In 1980, he built the St. Louis Eye Hospital, a 5millionnonprofitproject,whichwaslateracquiredbySt.MarysHospital.ShahnowlivesinCalifornia.Dr.Shahsgenerousgiftallowsustheopportunitytorecruitanationallyrecognizedretinalresearcherandaccomplishededucator,saidDr.OscarA.Cruz,chairmanofSLUsdepartmentofophthalmology.Dr.AnwarShah100yearsofwomenatSLUIn1908,fivewomenmadehistoryatSaintLouisUniversitySchoolofLawwhentheybecamethefirstwomenstudentsinthehistoryoftheUniversity.Tocelebratethefirst100yearsofwomenatSaintLouisUniversity,theSchoolofLawishostingaseriesofspeakersfocusingonissuesfacingwomeninthelegalprofession.Visitlaw.slu.edu/conf/womenforalistofupcomingspeakers.PhotosbySteveDolanNewsBriefsInJuly,TimBrookswasnamedtheUniversitysvicepresidentandchiefinformationofficer.Inhisnewrole,BrooksoverseesalloftheUniversitysinformationtechnologyfunctions.SinceNovember2007,BrookshadservedasSLUsqualityassuranceadministrator.Dr.PhilipAlderson,deanoftheSchoolofMedicineandanationallyrecognizedradiologist,hasbeennamedtotheadvisorycouncilfortheNationalInstituteofBiomedicalImagingandBioengineering,oneoftheNationalInstitutesofHealth.Spanningmorethanthreedozenspecialties,124doctorsfromSLUCarehavebeenselectedforSt.LouisMagazines2008BestDoctorslist.ThelistisbasedontheannualBestDoctorsinAmericadatabase,whichconsidersmorethanonemillionpeerevaluationstocreateadirectoryofapproximately30,000doctors.JeanGilmanisthenewdeanofundergraduateadmission,managingallofthedaytodayactivitiesofundergraduaterecruitment.Previously,shewasthedirectoroftheofficeofrecruitmentatMarshallUniversity.Dr.RaymondSlavin(Med56),professorofinternalmedicineandmolecularbiologyandimmunologyandamedicalschoolfacultymemberfor43years,receivedaLifetimeAchievementaward,thehighesthonorgivenbytheSt.LouisBusinessJournalatitsHealthCareHeroesrecognitionceremonyinOctober.Dr.MarlaBergWeger,seniorassociateprovostofacademicaffairs,nowalsoisthedeanoftheSchoolforProfessionalStudies.SheformerlyservedasinterimdeanoftheCollegeofEducationandPublicService.SLUs2008RelayforLifetobenefittheAmericanCancerSociety,heldinApril,wasrecognizedassecondlargestcollegiateeventinthenationpercapita.ThismarksthethirdconsecutiveyearthatSLUseventhasplacedinthetopfiveinthenation.SLUparticipantsraisedmorethan5 million nonprofit project, which was later acquired by St. Mary’s Hospital. Shah now lives in California. “Dr. Shah’s generous gift allows us the opportunity to recruit a nationally recognized retinal researcher and accomplished educa-tor,” said Dr. Oscar A. Cruz, chairman of SLU’s department of ophthalmology. Dr. Anwar Shah 100 years of women at SLU In 1908, five women made history at Saint Louis University School of Law when they be-came the first women students in the history of the University. To celebrate the first 100 years of women at Saint Louis University, the School of Law is hosting a series of speakers focusing on issues facing women in the legal profession. Visit law.slu.edu/conf/women for a list of upcoming speakers. Photos by Steve Dolan News Briefs In July, Tim Brooks was named the Univer-sity’s vice president and chief information of-ficer. In his new role, Brooks oversees all of the University’s information technology functions. Since November 2007, Brooks had served as SLU’s quality assurance administrator. Dr. Philip Alderson, dean of the School of Medicine and a nationally recognized radiolo-gist, has been named to the advisory council for the National Institute of Biomedical Imaging and Bioengineering, one of the National Insti-tutes of Health. Spanning more than three dozen special-ties, 124 doctors from SLUCare have been selected for St. Louis Magazine’s 2008 “Best Doctors” list. The list is based on the annual “Best Doctors in America” database, which considers more than one million peer evalu-ations to create a directory of approximately 30,000 doctors. Jean Gilman is the new dean of undergradu-ate admission, managing all of the day-to-day activities of undergraduate recruitment. Previously, she was the director of the office of recruitment at Marshall University. Dr. Raymond Slavin (Med ’56), professor of internal medicine and molecular biology and immunology and a medical school faculty member for 43 years, received a Lifetime Achievement award, the highest honor given by the St. Louis Business Journal at its Health Care Heroes recognition ceremony in October. Dr. Marla Berg-Weger, senior associate pro-vost of academic affairs, now also is the dean of the School for Professional Studies. She formerly served as interim dean of the College of Education and Public Service. SLU’s 2008 Relay for Life to benefit the American Cancer Society, held in April, was recognized as second largest collegiate event in the nation per capita. This marks the third consecutive year that SLU’s event has placed in the top five in the nation. SLU participants raised more than 160,000. 4 U NI V E R S I T A S w w w. s l u . e d u U N I V E R S I T A S F A L L 2 0 0 8 5 CONVOCATION CELEBRATION For the first time, in August Saint Louis University’s annual convocation to welcome new students and their families to the SLU community was held at Chaifetz Arena. Previously held in St. Francis Xavier College Church, convocation moved to the arena this year to allow more faculty and staff to participate in the event. { on campus } Viewing Heritage Hall on the day of its dedication are (from left): Dr. Patricia Demuth, former coordinator of gerontological nursing at the School of Nursing; Sister Noreen McGowan (seated), former faculty member and director of nursing at Cardinal Glennon Children’s Hospital; and Virginia Patton Spe-noga, former faculty member. Nursing School marks anniversary with Heritage Hall installation When Saint Louis University School of Nursing marked its 80th anniversary by unveiling its Heritage Hall, one sec-tion was left empty by design. “Visitors to Heritage Hall will learn of the many greats we have achieved as an innovator in nursing education. But the best is yet to come,” said Dr. Teri Murray (Nurs ’79, Grad ’93, ’97), dean of the School of Nursing. Located on the second floor of the School of Nursing Building, Heritage Hall is a three-dimensional timeline of the School of Nursing’s milestones. It was dedicated Sept. 27. A seed donation for Heritage Hall was made in honor of Dr. Joan Carter (Nurs ’58, Grad ’62), associate dean emerita of the School of Nursing. Alumni and other friends of the School of Nursing contributed to the historical remembrance. Faculty from Saint Louis University’s Doisy College of Health Sciences and the department of nutrition and dietetics’ Fresh Gatherings cafeteria are featured in a book by author Patricia Corrigan called Eating St. Louis: The Gate-way City’s Unique Food Culture. The hardcover book serves up stories and photos of the places, people and foods that have come to define and feed St. Louis. It also features little-known tales about local restaurants, food manufacturers, groceries and specialty food shops. Eating St. Louis can be ordered online at: www. eatingstlouis.com. Doisy College featured in book Rec Center reminder Whether you’re a member of SLU’s Simon Recreation Center or not, alumni may enroll in most of the center’s fitness classes, including Pilates, yoga, aerobics, spinning, kickboxing, bouldering and swimming. Several dance classes also are offered. There is a moderate fee for class enrollment, and all skill levels are welcomed. Classes and schedules vary, so visit www.slu.edu/ organizations/crcisc for details or call (314) 977-3969. As the Billiken celebrates his 100th birthday Issues of Universitas that feature the Billiken on the cover (including this one) NCAA Division I Billiken teams at SLU Billiken statues on campus (plus, there’s a Billiken-shaped topiary) Individuals inducted into SLU’s athletic Billiken Hall of Fame Pageviews of SLU’s “What’s a Billiken?” page (www.slu.edu/billiken.xml) during the last three months 8 18 2 227 5,397 t h e A R T S a t S L U SLUMA shows ‘Diebenkorn, Hockney and Dine’ works The Saint Louis University Museum of Art is present-ing “Diebenkorn, Hockney and Dine: Selected Prints from the Bank of America Collection.” This iconic trio of contemporary artists is represented by more than 100 of their respec-tive prints spanning the period between 1950 and 1986. The works on paper reveal explorations into the aesthetics of line, color and formal complexity. SLUMA’s hours are 11 a.m. to 4 p.m., Wednesday through Sun-day. For more information, visit sluma.slu.edu. MOCRA’s ‘Pursuit of the Spirit’ marks 15 years This fall, visitors to SLU’s Museum of Contemporary Religious Art can view the exhibition “Pursuit of the Spirit,” which draws on art-ists and artworks selected from the museum’s first 35 exhibitions. As the museum celebrates its 15th an-niversary, the selections are dedicated to the ongoing dialogue between con-temporary artists and the world’s faith traditions. The museum is open 11 a.m. to 4 p.m., Tuesday through Sunday. For more informa-tion, call (314) 977-7170 or visit mocra.slu.edu. Campaign memorabilia on display at SLUMA The Saint Louis University Museum of Art is exhibit-ing “Persuasive Politics: Presidential Campaign Memorabilia.” Centuries of presidential memorabilia are showcased in the collec-tion: a George Washington coat button, an “I Like Ike” cigarette pack and an 1860 Abraham Lincoln campaign coin are among the more than 700 campaign items, ranging from the historic and stoic to the contemporary and whimsical. SLUMA’s hours are 11 a.m. to 4 p.m., Wednesday through Sun-day. For more information, visit sluma.slu.edu. Madonna and Child. Frederick J. Brown (1994-95), oil and mixed media on canvas. McKinley campaign pin with flag ribbon. Clubs-Blue Ground. Richard Diebenkorn (1982), etching, spitbite aquatint, drypoint. Public Health receives 26millioncontractTheNationalChildrensStudy,thelargeststudyeverconductedtolearnaboutthehealthanddevelopmentofchildren,hasselectedSLUsSchoolofPublicHealthtohelpexpanditsfootprintintheregion.ChildrenfromJeffersonCountyinMissouriandJohnson,UnionandWilliamsoncountiesinsouthernIllinoiswillbeamong100,000childrenacrossthenationwhomresearcherswillfollowfrombeforebirthtoage21tolearnmoreaboutenvironmentalandgeneticinfluencesondiseases.Astheleadstudysite,theSchoolofPublicHealthreceiveda26 million contract The National Children’s Study, the largest study ever conducted to learn about the health and development of children, has selected SLU’s School of Public Health to help expand its footprint in the region. Children from Jefferson County in Missouri and Johnson, Union and Williamson counties in southern Illinois will be among 100,000 children across the nation whom researchers will follow from before birth to age 21 to learn more about environmental and genetic influences on diseases. As the lead study site, the School of Public Health received a 26.3 million contract from the National Institutes of Health, the Centers for Disease Control and Prevention and the U.S. Environmental Protection Agency. The new contract is in addition to last year’s $26.8 million, five-year contract to the School of Public Health to follow the health of children from St. Louis City and Macoupin County in Illinois. FIRST CLASS This fall, Saint Louis University debuted a new classroom building at 3721 Laclede Ave. The building, which was the former home of Forest Pharmaceuticals, was completely gutted and renovated this summer. Now known as the Laclede Classroom Building, the fa-cility boasts 15 classrooms, a new forensics/anthropol-ogy lab and several seminar rooms. Photo by Steve Dolan Photo by Steve Dolan Photo by Kevin Lowder date opponent place time Nov. 05 vs. Harris-Stowe State St. Louis 7 p.m. (ExhIBITION) Nov. 14 vs. Missouri-St. Louis St. Louis 7 p.m. Nov. 19 vs. Kent State St. Louis 7 p.m. Nov. 22 vs. Boston College St. Louis 1 p.m. Nov. 25 at Nebraska Lincoln, Neb. 7 p.m. Nov. 29 at Detroit Mercy Detroit 1 p.m. Dec. 02 at Southern Illinois Carbondale, Ill. 7 p.m. Dec. 06 vs. Savannah State St. Louis 7 p.m. Dec. 13 vs. Samford St. Louis 4 p.m. Las Vegas Classic Dec. 17 vs. USC Upstate St. Louis 7 p.m. Dec. 19 vs. Liberty St. Louis 7 p.m. Dec. 22 vs. DePaul Las Vegas 7 p.m. Dec. 23 Las Vegas Classic Las Vegas 6:30 or Championship 9 p.m. Dec. 30 vs. UMBC St. Louis 8 p.m. Jan. 02 vs. North Carolina A&T St. Louis 7 p.m. Jan. 08 at Xavier Cincinnati 7 p.m. Jan. 14 vs. Massachusetts St. Louis 7 p.m. Jan. 17 vs. George Washington St. Louis TBA Jan. 22 at Temple Philadelphia 7 p.m. Jan. 25 vs. Richmond St. Louis 2 p.m. Jan. 29 at Dayton Dayton, Ohio 7 p.m. Jan. 31 at Fordham Bronx, N.Y. 6 p.m. Feb. 04 vs. Duquesne St. Louis TBA Feb. 08 at Richmond Richmond, Va. 1 p.m. Feb. 11 vs. Charlotte St. Louis 7 p.m. Feb. 14 at Rhode Island Kingston, R.I. 1 p.m. Feb. 1

    Universitas: the magazine of Saint Louis University

    No full text
    Winter 2014 issue of Universitas: the magazine of Saint Louis Universitywinter 2014 Oriflamme Marks 50 Years Page 12 Center for Global Citizenship Page 16 Alumnus Jimmie Edwards Page 18 Art Exhibit with Local Roots Page 22 Page 8 C O N T E N T S f e a t u r e s d e p a r tme n t s 8 | SLU Downtown The School of Law has moved into its new home in the heart of St. Louis’ legal community. — By Lauren Brucker 12 | Warm Welcome Oriflamme, the student welcome organization, celebrated its 50th anniversary this fall. — By Amy Garland 16 | Going Global The new Center for Global Citizenship has transformed the former West Pine Gym. — By Danielle Lacey 18 | The Power of Education Alumnus Judge Jimmie Edwards is redefining education for troubled youth in St. Louis. — By Laura Geiser 22 | No Place Like Home The latest exhibition at the Saint Louis University Museum of Art has local ties. — By Andrew Walker 2 | On Campus San Ignacio Hall /// Presidential search update /// SLU’s latest honors /// NASA collaboration /// Health clinic relocation 6 | Biliken News Basketball schedules /// Baseball coach recognized 7 | Advancement News The impact of scholarship gifts 23 | Clas Notes Catch up with classmates. 28 | In Memoriam Remembering those members of the SLU community who recently died 30 | Al u mni Events SLU alumni activities across the country 32 | Perspective A homily by the late SLU professor John Kavanaugh, S.J. 33 | The Last Word Letters to the editor Photo by JAMES VISSER Law students in the Louis Riethmann Pavilion on the 12th floor of Scott Hall. Volume 40, Issue 1 Editor Laura Geiser (A&S ’90, Grad ’92) contributors Lauren Brucker Amy Garland (A&S ’97) Danielle Lacey Katie O’Connor (A&S ’97) Andrew Walker On Campus news stories University Communications Medical Center Communications Billiken Media Relations ON THE Cover Joe and Loretta Scott Hall, the new home of the School of Law, in downtown St. Louis. Photo by James Visser Design Art Direction: Matt Krob Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, One N. Grand Blvd., St. Louis, Mo. 63103. We accept email at universitas@ slu.edu and fax submissions at 314-977-2249. Address fax submissions to Editor, Universitas. Postmaster: Send address changes to Universitas, Saint Louis University, One N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: universitas.slu.edu Universitas is printed by Universal Printing Co. Worldwide circulation: 121,150 © 2014, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. F A L L 2 0 0 4 W I N T E R 2 0 0 5 It is a pleasure to take this opportunity to address Saint Louis University alumni via Universitas. As a longtime reader of this maga-zine, it is certainly a different experience to be writing a mes-sage for it. As you may know, I have spent the past 18 years of my career at SLU serving as the University’s general counsel. So in August I did not anticipate being asked to become SLU’s interim pres-ident. Though the request was unexpected and I had been perfectly content in my position as a university attorney, I could not say no. Saint Louis University is an institution I truly love and have been honored to serve, so taking on this new role was the right thing to do. Since my appointment became effective on Sept. 2, I have gained an even greater appre-ciation for the importance and impact of this outstanding institution. As general counsel, I met and worked with many people across the University, but as interim president I have got-ten to know so many more who are equally as passionate about Saint Louis University and about Jesuit education as I am. In October I had the privilege of attending a historic meeting with the superior general of the Society of Jesus, Adolfo Nicolás, S.J., who was visiting from Rome. Held in Chicago and hosted by the Association of Jesuit Colleges and Universities, the gathering included the presidents and board chairs from all 28 U.S. Jesuit colleges and universities. It truly was an honor for me to join this august group of lead-ers at this first-ever meeting of its kind. During his remarks Father Nicolás reminded us of how the spirituality of St. Ignatius Loyola, founder of the Jesuits, can inspire us today. He said: “In the understanding of St. Ignatius, the principal function of a leader is to help the members of a community grow to become the living presence of God in the world.” Perhaps it was the timing, but that statement struck a chord with me. I always had been aware of the University’s efforts to encourage growth and transformation. But as interim president I know I am seeing Saint Louis University in an entirely new light. I am meeting students who truly embrace our Catholic, Jesuit values. Whether serving their fellow students, tutoring young people or serving meals to the poor, they truly live our mission. I also am meeting faculty who fully embrace their roles as leaders and show our stu-dents how “to become the living presence of God in the world.” Our professors teach at prisons, create healthier school lunches for local districts and travel the world to aid indigent communities, assisting with everything from health care to clean water wells. Finally, I am meeting alumni who are living the lessons they learned at Saint Louis Uni-versity. In November I started gathering with alumni groups to provide an update on all of the great things happening at the University and to answer questions about SLU. The first event was held in St. Louis, and in December I met with alumni in Chicago. In the spring I plan to travel to even more cities to hold these information-sharing sessions. For me, the best parts of these meetings come before and after my remarks, when I have time to talk one-on-one with our alumni. I have met so many SLU graduates who are making a dif-ference in our world in big and small ways. They truly illustrate for me the power and promise of a Saint Louis University education. I also have enjoyed experiencing the enthu-siasm our alumni have for their alma mater. Indeed, Saint Louis University is a wonderful place, and I am humbled to be at the helm, at least for a little while. Please know I am always interested in hear-ing from alumni. If you would like to reach out to me, please send an email message to [email protected]. William R. Kauffman Interim President P R E S I D E N T ’ S M E S S A G E 2 | U N I V E R S I T A S | w w w. s l u . e d u wi n t e r ’ 1 4 | U N I V E R S I T A S | 3 Presidential Search Underway In September, the Sa int L oui s University board of trustees officially launched the search for a new university president by establishing a search com-mittee and by engaging the consulting firm AGB Search. The search commit-tee is chaired by trustee Jim Smith, and its members are: James Burshek, S.J. (A&S ’69), trustee Anne Gagen (Cook ’72, Grad Cook ’76), trustee Dr. Jeffrey Gfeller, professor and chairman, psychology department, College of Arts and Sciences John Griesbach, professor, School of Law Al Litteken, trustee Dr. Teri Murray (Nurs ’79, Grad Nurs ’93, E&PS ’97), dean, School of Nursing Dr. Frank O’Donnell, trustee Vidur Sharma, president, Student Government Association Patrick Sly (Grad Cook ’77), vice chairman of the board and trustee Dr. Jane Turner (A&S ’85, Grad ’91, Med ’92), president, Faculty Senate This fall, Smith and AGB Search’s managing partner, Dr. Jamie Ferrare, met with various University groups to discuss the presidential search and to learn about the characteristics and qualities that the SLU community seeks in its next president. They received input from hundreds of people via direct meet-ings and emails. In October, the committee released the presidential position description, which was approved by the board. This description can be found online at slu.edu/presidential-search. The committee is now in the next phase of the search, which includes identifying prospective candidates and discussing SLU’s presidential position with them. In January, the search committee will work to narrow the candidate list to approx-imately two or three candidates who can be proposed to the board for review. “We are very enthused about all the advantages that Saint Louis University has to offer a prospective president,” Smith said. “And speaking for the search committee, I can assure you we will do everything possible to find a great new leader for Saint Louis University.” Accolades for SL U ’s Academics, Service and Value Ranked among the top Jesuit universities in the coun-try, Saint Louis University continues to earn praise from new sources as well as established ones. Here are some of the University’s most recent honors. University Dedicates San Ignacio Hall in Madrid Saint Louis University’s Spanish presence continues to grow. In September, the University celebrated the opening of its newest building in Madrid, San Ignacio Hall. The recently renovated, 26,000-square-foot building nearly doubles the size of SLU-Madrid and adds a new library, classroom space, art and dance studios, and a restaurant. Photo by Ángel García López o n c a m p u s Princeton Review best college Saint Louis University made the Princeton Review’s The Best 378 Colleges: 2014 Edition. Only about 15 percent of America’s 2,500 four-year colleges are profiled in the book. The profile of SLU highlights its “solid academic programs” and sustainability efforts. The Princeton Review also called SLU a place where “service, social justice and political awareness are stressed at every level of education.” Top Marks for Commitment to Service For the third year in a row, Washington Monthly ranked SLU among the top five universities in the nation for community service. The publication looks at schools’ contributions to the public good in three categories: social mobility, research and service. SLU was No. 4. The University also earned list-ings as “Top Jesuit School” and “Top Faith-Based School,” as well as second place on the list of top private institutions. In addition, SLU was one of a handful of institutions rec-ognized at the President’s Interfaith and Community Service Campus Challenge National Gathering in September. Started by President Barack Obama in 2011, the chal-lenge calls for campuses to increase interfaith service and engagement over the course of one year. The University was honored for hosting nearly 100 interfaith events. Finally, SLU placed fifth on Hercampus.com’s 2013 list of “The Most Charitable Schools.” Hercampus.com is a colle-giate guide and news network for women college students. Kiplinger’s best values in private colleges The University was recognized for affordability and academic quality among Kiplinger’s “Best Values in Private Colleges.” The 2014 list includes the top 200 private colleges in the country. Saint Louis University has appeared on the list multiple times. Sierra Club cool school SLU was named one of Sierra Club’s “Cool Schools,” an honor given by the environmental organization to colleges and universities around the country that are committed to sustainability. The list recognizes green accomplishments and efforts, such as faculty and departments engaged in sustainability research, and sustainability-themed courses or curricula. CollegesofDistinction.com college of distinction One of six Missouri schools — and the only institution from St. Louis — to make the 2013-14 list, the University was selected for its commitment to four areas: engaged students, great teaching, vibrant community and successful outcomes. SLU was also selected as a “Catholic College of Distinction.” Smith 4 | U N I V E R S I T A S | w w w. s l u . e d u wi n t e r ’ 1 4 | U N I V E R S I T A S | 5 SL U ’s Free Medical Clinic Relocates in North St. Louis Sa int Louis Univer s it y’s Hea lth Resource Center, a free clinic oper-ated by medical school students under the guidance of SLU faculty physicians, cele-brated its 20th anniversary of caring for the underserved and underinsured with a move to a newer, larger facility in north St. Louis. The new site is known as the Jesuit Health Resource Center. Dr. Eva Frazer, a former member of SLU’s board of trustees, and her hus-band Steven Roberts donated the space. The new clinic has a large patient waiting room, six patient exam rooms, a social work room, a conference room, multipurpose rooms, expanded lab space and a classroom. With the additional space, SLU is exploring the possibility of offering other services. Last year the Health Resource Center served more than 1,000 patients at primary care, well women and pediatrics clinics. About 73 percent lacked insurance. Students began seeing patients in the new space during their regular Saturday morning session late this summer. NIH Taps SL U to Bid on Nearly 1BillionforVaccineDevelopmentSLUsCenterforVaccineDevelopmentisamonganelitegroupofnineVaccineandTreatmentEvaluationUnits(VTEUs)selectedbytheNationalInstitutesofHealth(NIH)tobidonnearly1 Billion for Vaccine Development SLU’s Center for Vaccine Development is among an elite group of nine Vaccine and Treatment Evaluation Units (VTEUs) selected by the National Institutes of Health (NIH) to bid on nearly 1 billion in projects to study infectious diseases, including emerging threats. The National Institute of Allergy and Infectious Diseases, part of the NIH, has funded vaccine research at SLU since 1989. The new contract represents what likely is the largest research contract or grant in the University’s history. SLU received an “Indefinite Delivery Indefinite Quantity” contract with an estimated value of up to 135millionintaskordersannuallyduringthecourseofthesevenyearorderingperiod���oranestimatedvalueofupto135 million in task orders annually during the course of the seven-year ordering period ��� or an estimated value of up to 951 million for the contract duration. Only centers accepted as VTEUs can bid on specific projects. This is a change in the federal funding mechanism for vaccine research, said Dr. Robert Belshe, director of the Center for Vaccine Development and principal investigator on the project. Business EnDowed Professor Named The John Cook School of Business has appointed Dr. Bidisha Chakrabarty, associate professor of finance, to the Edward Jones Endowed Professorship in Finance. Edward Jones created the endowed pro-fessorship in 2007 to recognize an expert in finance who provides academic leadership through teaching, research and service. Chakrabarty joined the business school facult y in 2003. She has received the Outstanding Faculty Award given by the John Cook School of Business Alumni Board, the Kwak Research Award for the best research productive faculty, the ICRIER policy paper grant and the National Stock Exchange of India Research Initiative Grant. Chakrabarty is a lso a consultant to Beyond Housing, an organization that helps families facing foreclosure. She is an author and researcher on the topics of mar-ket microstructure, securities regulation, disclosure and market reaction, and market design and price discovery. Parks Students, NASA Launch Camera into Space COPPER (SLU- 01), Saint Louis Univer s i t y ’s f i r s t spacecraft designed, bui l t , t e s t e d and operated by students at Parks College of Engineering, Aviation and Technology, launched Nov. 19 from the Mid-Atlantic Regional Spaceport at Wallops Island, Va. The Air Force Research Laboratory and NASA Missouri Space Grant funded the project development, and the launch of COPPER was sponsored by NASA. COPPER is a one kilogram, 10-centimeter cube and is made of commercially available spacecraft parts and stu-dent- developed electronics. The mission tests the effectiveness of a commercial infra-red camera for in-space navigation and object detection, as well as observes the Earth in the infrared spectrum. For the next 12 months, Parks College students will operate COPPER from a radio control station in McDonnell Douglas Hall on the SLU campus. The space-craft will de-orbit naturally in less than four years. COPPER is a product of the Space Systems Research Laboratory, which is led by Dr. Michael Swartwout and Dr. Sanjay Jayaram of the department of aerospace and mechanical engineering, and Dr. Kyle Mitchell of the department of electrical and computer engineering. More than 50 undergraduate and graduate students worked to create COPPER during the past three years. Class of 2017 boasts high marks This fall, SLU welcomed one of the largest and most academically gifted freshman classes in University history. The Class of 2017’s credentials include a mean high school GPA of 3.81 and an average ACT score of 27.6. Geographically, 44 states and 24 countries are represented in this year’s freshman class, and nearly 75 percent of SLU��s new students hail from outside the St. Louis metropolitan area. By The Numbers 2013 Make A Difference Day: SLU’s 16th annual day of service in October was one of the largest in University history. TIAA-CREF was the primary financial sponsor for the event. 3,691 participants 91% of the volunteers were students. 312 faculty, staff, alumni and parents participated. 197 Kappa Delta sorority sisters made the largest volunteer team. 140 community organizations, schools, churches and homes benefited — the most sites in the event’s history. News Bri e fs University President Emeritus Lawrence Biondi, S.J., received the 2013 Mayor’s Award for his influence on economic development in the city of St. Louis. During Biondi’s tenure, the University had a major impact on the region’s economy; an independent study found that SLU generated $715.5 million in economic impact during 2011 alone. St. Louis Mayor Francis G. Slay (Law ’80) presented the award in October. J. Joe Adorjan (Cook ’63, Grad Cook ’67), chairman of the University’s board of trustees, was awarded the Hungarian Order of Merit-Knight’s Cross, Hungary’s highest state honor. Adorjan is the honorary general consul of Hungary as well as the founder of the Hungarian-Missouri Educational Partnership, which links four Missouri universities, including SLU, with five Hungarian universities to enhance the education of emerging leaders who will help create a lasting bond between the two countries. Dr. Alexander Garza (PH ’03), the former assistant secretary for health affairs and chief medical officer for the Department of Homeland Security, has joined the faculty of the College for Public Health and Social Justice. Garza is associate dean for public health practice and associate professor of epidemiology. David Cassens is the new dean for University Libraries. He has served as interim University librarian since June 2012. Previously he served as assistant university librarian for administration and director of Pius XII Memorial Library. He has worked at SLU for nearly 15 years. In October, Dr. Mildred Mattfeldt-Beman (Grad E&PS ’92), chair of the department of nutrition and dietetics, received a Medallion Award from the Academy of Nutrition and Dietetics for guiding her department to national prominence. Mattfeldt-Beman has built a program that is a community resource — advising congressmen, creating healthier school lunches and promoting business in the region. Dr. Mike Shaner, professor at the John Cook School of Business, has been named the “Best Management Professor” by the World Education Congress in Mumbai. Shaner was recognized as a thinker and doer who served as a “role model and a believer in change.” He joined the SLU faculty in 1974. Dr. Diana Carlin, associate vice president for graduate education and international initiatives, was one of 11 U.S. administrators selected by the U.S. and French Fulbright commissions to participate in a two-week seminar in France in October. The purpose was to help both the Americans and French better understand the other’s higher education and research areas, and to explain partnership opportunities with French universities. o n c a m p u s HOMECOMING 2013: Saint Louis University’s 2013 Homecoming and Family Weekend drew nearly 2,500 people to campus Sept. 27-29. The celebration included the popular golf cart parade, with the theme “Meet Me in St. Louis,” and celebrations of SLU’s Golden Billikens, members of the class of 1963 and earlier. The weekend was capped off with a win by the men’s soccer team and a spectacular fireworks display. The 2014 Homecoming will be Sept. 25-28. Photo by Steve Dolan Olivia Johnson gets her ears examined at the clinic by faculty volunteer Dr. Marilyn Maxwell, professor of internal medicine and pediatrics. A student building COPPER (SLU-01). From left: Dr. Scott Safranski, interim business dean; Chakrabarty; Robert J. Ciapciak (Grad Cook ’82) of Edward Jones; and Interim President William Kauffman. pictured: Students packing meals for Feed My Starving Children on Make A Difference Day. Photo by Kevin Lowder Photo by Kevin Lowder Photo by Katie O’Connor 6 | U N I V E R S I T A S | w w w. s l u . e d u wi n t e r ’ 1 4 | U N I V E R S I T A S | 7 When Saint Louis University freshman Michael Milek got a call with scholarship news last spring, he wasn’t imme-diately sure the news was good. “At first I didn’t think I got it because of the tone of the caller,” said Milek, an athletic training major in Doisy College of Health Sciences. “However, he told me that I received it, and I was really happy.” The Philadelphia native had been awarded the Martin Luther King Jr. Scholarship, a merit-based University scholarship granted to students with a mix of academic achievement, demonstrated leadership and commitment to service. The scholarship w

    Universitas: the magazine of Saint Louis University

    No full text
    Summer 2018 issue of Universitas: the magazine of Saint Louis University. This is a special Bicentennial issue, celebrating the University's 200th anniversaryUNIVERSI TAS 2 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 1 BICENTENNIAL P R E S I D E N T ’ S M E S S A G E VOLUME 4 4, ISSUE 2 EDITOR Laura Geiser (A&S ’90, Grad ’92) ASSOCIATE EDITOR Amy Garland (A&S ’97) ART DIRECTOR Matt Krob CONTRIBUTORS Anne Marie Apollo-Noel Dr. Dolores Byrnes Molly Daily (Grad A&S ’18) Marie Dilg (Grad SW ’94) Sarah Hilgendorf ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER Detail of a window in St. Francis Xavier College Church depicting the north entry of DuBourg Hall flanked by graduates. The word “Christocracy” in red letters above the entry indicates Christ’s influence on education. The window was designed by Emil Frei Jr. and installed in the 1930s. Photo by J.J. Mueller, S.J. (A&S ’69, Grad A&S ’70) Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, One N. Grand Blvd., St. Louis, MO 63103. We accept email at [email protected]. Postmaster: Send address changes to Universitas, Saint Louis University, One N. Grand Blvd., St. Louis, MO 63103. Website: slu.edu/universitas Universitas is printed by Henry Wurst Inc. Worldwide circulation: 116,500 © 2018, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. Detail of two windows in St. Francis Xavier College Church that spotlight academic disciplines and sit on each side of the window on this issue’s cover. On the left, painting and music are depicted. On the right, mathematics and science are shown. PHOTOS BY J.J. MUELLER, S.J. PHOTO BY JAY FRAM F E ATU R E S D E PARTME NTS 10 The First Two Centuries A 200-year timeline of Saint Louis University — By Molly Daily 16 Always at the Frontier An excerpt from the official bicentennial book — By Dr. Dolores Byrnes 20 Exhibiting History The Saint Louis University Museum of Art’s new exhibition — Photos by Steve Dolan 24 Talking About My Generation Campus activities and hangouts since the 1940s — By Amy Garland 29 The Bicentennial Logo The hidden details of SLU’s 200-year mark — Designed by Matt Krob 30 More Than a Job Reflections from 10 longtime faculty and staff — By Marie Dilg 36 Cover Story Telling SLU’s history through its alumni magazines — By Laura Geiser 40 Making Good Time An update on the bicentennial service challenge — By Anne Marie Apollo-Noel 2 On Campus Major gift to the business school /// Madrid’s 50-year celebration /// 2018 commencement /// Climate Summit /// Prospect Yards /// Gift for nursing scholarships /// Literary Award to Sondheim 42 Class Notes 43 Alumni Spotlight Eric Moraczewski (CSB ’04) 46 In Memoriam 48 Feedback 49 The Last Look Our beloved University is worthy of celebration — both for the memorable achievements of our shared past and for the many impressive ways in which we live our mission today. We began this past academic year with the bicentennial Mass. As we planned it, I believed that it would be remembered as one of the very best moments in our history. An email I received from a parent of one of our students confirmed that to me. He said, “As I sat at the 200th anniversary Mass, with its gorgeous backdrop and significant history, I was brought to tears by the humbling appreciation that my daughter could attend a university like SLU.” This gratitude for SLU and our his-tory set the tone. More recently, as part of our bicentennial celebration, we hosted the Saint Louis Climate Summit and brought together world-re-nowned speakers Cardinal Peter Turkson, Dr. Mario Molina, Carl Pope and Bill Nye to examine a path forward for our planet. (Read more on page 5.) The Climate Summit was born out of the desire to respond to Pope Francis’ call to care for all of creation, especially our environ-ment, in his encyclical Laudato Si’. Chaired by SLU’s own Dr. Jack Fishman (Grad A&S ’74, ’77) and David Webb (A&S, CSB ’97, Grad ’12), and planned with support from Dr. Peter Raven and trustee Trudy Busch Valentine (Nurs ’80), the summit attracted meteorol-ogists; government leaders; experts in climate science, ecology and sustainable development; students; and engaged St. Louisans for three days of discussion. In affirmation of this summit, I received a letter from Cardinal Pietro Parolin, who is the secretary of state for the Vatican. In the letter, Cardinal Parolin quotes Pope Francis’ prayer that, “This gath-ering may serve to inform society more effectively on the issue of climate change and encourage the University community ‘to pro-mote best practice, to stimulate creativity in seeking new solutions and to encourage individual or group initiatives.’” In addition to these and other impressive events and academic programs, our bicentennial has inspired an outpouring of support from our community. Our stakeholders are demonstrating their belief in the importance of our work by investing in SLU. We are in the midst of the single greatest fundraising year in SLU history. Further, we are confident we will end this year at more than twice our previous all-time total. This February, trustee Dr. Richard Chaifetz (A&S ’75) and Jill Chaifetz made a transformational gift of 15milliontoourbusinessschool,bringingtheirlifetimecontributionstoSLUto15 million to our business school, bringing their lifetime contributions to SLU to 27 million. Their latest gift is intended to grow SLU’s nationally ranked entre-preneurship center and provide resources for other programs in the newly named Richard A. Chaifetz School of Business. (Read more on page 2.) Thank you to each of our alumni who have contributed to this historic fundraising year. Your gifts support innovation, academic excellence, scholarship and informed medicine. They will invigo-rate Saint Louis University, and reflect your confidence in our plan for the future. The very near future holds two outstanding opportunities for all of us to come together to celebrate SLU’s first two centuries. I hope you will join us for a Grand Celebration on Saturday, Sept. 29, during our special bicentennial Homecoming and Family Weekend. This evening will feature live music, food and fun activities for all ages. And on Thursday, Nov. 15, I invite you to a 200th birthday celebration featuring a private concert by the St. Louis Symphony Orchestra at Chaifetz Arena. As we all celebrate this historic milestone, our University is part-nering in shaping the direction of our region, and we are doing wonderful work in the classroom, in the laboratory, in the hospi-tal and in the community. Your support during our past and in the present is vital to our future. While you read, I hope you’ll learn new facts about your alma mater, reminisce about your time here and be inspired by the stories of those who shaped our beloved institu-tion. I would be delighted to hear your reflections. May God bless you, and may God continue to bless Saint Louis University. Dr. Fred P. Pestello President This special issue of Universitas takes you on a journey though Saint Louis University’s past. The timeline, book excerpt, faculty memories and photos that you will find on the following pages all serve to remind you of SLU’s noble history. UNIVERSI TAS 2 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 3 BICENTENNIAL Chaifetz Family Gift Leads to Business School’s New Name In February, SLU trustee Dr. Richard A. Chaifetz (A&S ’75) and his wife, Jill Chaifetz, increased their giving to Saint Louis University to 27million,including27 million, including 15 million to the business school. In 2007, the couple provided the lead gift of 12 million that enabled the construction of Chaifetz Arena. To honor this new, generous contribution, the University has renamed its business school the Richard A. Chaifetz School of Business and the school’s entrepreneurship center the Chaifetz Center for Entrepreneurship. SLU students, faculty and staff members turned out to thank Chaifetz during a special reception on Feb. 22. In his remarks, Chaifetz briefly told the story of how former SLU President Paul Reinert, S.J., allowed him to remain at SLU when financial issues threatened his ability to stay. Chaifetz promised Reinert that he would pay back his tuition — and that he would pay back the University in an even bigger way in the future. “This allows me to give back to a school I love, am passionate about and want to make even greater,” Chaifetz told the large crowd. “I want to hear the Chaifetz School of Business mentioned in the same breath as other great business schools.” The Richard A. Chaifetz School of Business has seven programs nationally ranked by U.S. News and World Report — three undergraduate and four graduate — including the country’s No. 9-ranked undergraduate entrepreneurship program. Chaifetz is a world-renowned entrepreneur and business leader, who in 1984 founded ComPsych Corp., today the world’s largest provider of employee assistance programs, behavioral health and wellness services. The company, of which he remains founder, chairman and CEO, provides services to more than 100 million individuals and 45,000 organizations in more than 160 countries. He also is founder and chairman of the private investment firm Chaifetz Group. He has been a member of SLU’s board of trustees since 2007 and was an inaugural member of the business school’s Entrepreneurial Hall of Fame. ON C AMPUS PHOTOS BY STEVE DOLAN Chaifetz addresses the crowd. Chaifetz (left) and SLU President Dr. Fred P. Pestello talk with students at the February event. Guests gathered in the in the Shanahan Atrium of Cook Hall listen to Chaifetz. UNIVERSI TAS 4 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 5 BICENTENNIAL 2018 Commencement Celebrates the Bicentennial With SLU’s bicentennial in mind, the University began a new tradition at the May 19 com-mencement ceremony at Chaifetz Arena as members of its Class of 1968 — now called Golden Billikens — led the entry procession and received special recognition. Golden Billikens will be honored at University commencements going forward. In another nod to the bicentennial, SLU reintro-duced its “Varsity Song,” which was written in 1909 and had not been performed at commencement since the 1960s. (See the original on page 19.) It was updated by Dr. Aaron Johnson, assistant professor of music, and sung by the University’s Mastersingers. More than 2,100 students graduated this spring. This year’s commencement speaker was Ronald Mercier, S.J., provincial of the Jesuits’ U.S. Central and Southern Province. He received an honorary doctor of divinity from the University. Also honored with honorary degrees during the ceremony were two SLU alumni, former U.S. Congressman William “Bill” Lacy Clay Sr. (A&S ’53) and former St. Louis Mayor Francis G. Slay (Law ’80). The student speaker from the graduating class was new law alumna Sarah Tomlinson. University archi-vist emeritus John Waide (A&S ’73) was the mace bearer. Climate Summit Draws Thousands Saint Louis University brought toge t her some of the most author-itative minds in climate science, ecology and sus-tainable development for the 2018 Saint Louis Cl imate Summi t thi s April. A highlight of SLU’s yearlong bicentennial celebration, the three-day summit was inspired by Pope Francis’ 2015 encyclical Laudato Si’ that called attention to humankind’s responsibility to care for the earth in the wake of climate change. Nearly 2,300 students, faculty and members of the St. Louis community attended the summit’s keynote address at Chaifetz Arena. The speakers were Carl Pope, former executive director of the Sierra Club and co-author of Climate of Hope: How Cities, Businesses and Citizens Can Save the Planet, and Bill Nye “The Science Guy,” well-known science educator and advocate. The summit featured experts from around the world, including Cardinal Peter Turkson, prefect of the Dicastery for Promoting Integral Human Development; Dr. Mario Molina, 1995 recipient of the Nobel Prize in Chemistry; recipients of various United Nations Environmental Awards; and members of the Pontifical Academy of Sciences, the primary scientific advisory council to the pope. Panelists presented about food security, water availability, rising sea levels, busi-ness issues related to climate change and more. More than 220 people attended the academic portion of the summit, which was shared worldwide online. The summit was organized by Dr. Jack Fishman (Grad A&S ’74, ’77), professor of earth and atmospheric sciences and director of SLU’s Center for Environmental Sciences, and David Webb (A&S, CSB ’97, Grad ’12), director of SLU’s Emerson Leadership Business Institute. Dr. Peter Raven, president emeritus of the Missouri Botanical Garden, and Trudy Busch Valentine (Nurs ’80), a SLU trustee, were key members of the planning team. During February and March, SLU competed in the annual nationwide RecycleMania competition, an eight-week event that raises awareness about campus sustainability. 8th year participating in RecycleMania 331,762 lbs. of single-stream recycling collected by SLU 86,267 lbs. of electronics collected during the E-Waste Drive 4th place in the national electronic recycling competition 25,721 lbs. of old documents shredded and recycled during ShredMania event 443,750 lbs. total diverted from landfills by SLU this RecycleMania IN ADDITION TO THE CLIMATE SUMMIT, HERE ARE A FEW HIGHLIGHTS OF THIS SPRING’S BICENTENNIAL EVENTS: O N C A M P U S BY THE NUMBERS RecycleMania Students volunteer at March’s E-Waste Drive, part of the national RecycleMania competition. SUBMITTED PHOTO Nye (left) and Pope give the keynote address at Chaifetz Arena. PHOTO BY SIMON NGUYEN INTERCULTURAL ORIGINS OF ST. LOUIS AND THE TRANS-MISSISSIPPI WEST, 1800-1840 This conference examined themes including the international influences present in early St. Louis, and the expansion of the St. Louis region. WOMEN AT SLU: THE STRUGGLE FOR KNOWLEDGE, POWER AND LEGACY This symposium discussed both the challenges and opportunities women confront as female students, staff and faculty at SLU. FROM SELMA TO ST. LOUIS: THEOLOGY OF MARTIN LUTHER KING JR., AND THE PURSUIT OF JUSTICE 50 YEARS LATER This public symposium offered performances and reflections on King’s legacy of liberation and justice. PHOTO BY SIMON NGUYEN Turkson (left) and Molina Confetti and streamers were released at the end of the ceremony in Chaifetz Arena. Graduates’ caps Honorary degree recipients (from left) Slay, Mercier and Clay Doisy College of Health Sciences graduates PHOTOS BY STEVE DOLAN UNIVERSI TAS 6 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 7 BICENTENNIAL SLU, St. Louis Archdiocese Sign Agreement to Enrich Seminarian Education St. Louis Archbishop Robert J. Carlson and SLU President Dr. Fred P. Pestello signed an agree-ment in April that brings the Kenr ick-Glennon Seminary undergraduate program fully into SLU’s College of Philosophy and Letters, which oversees pro-grams for students training for the priesthood and ministry. Currently, seminarians take their first two years of undergraduate classes at SLU and finish their education at the seminary, receiving a degree from Kenrick- Glennon Seminary. Under the new agreement, seminarians will receive a Bachelor of Arts degree in philosophy from SLU, taking classes taught both at SLU and at the seminary. The program changes will be implemented for the 2018-19 school year. The seminarians will be able to explore other disciplines while at SLU. Carlson said he hoped that many would take advantage of the language arts and minor in Spanish, as the archdiocese has a growing Spanish-speaking population. Graduate Programs Earn High U.S. News Rankings The health law program in the Saint Louis University School of Law has been named the best in the nation by health law scholars for the 14th year, according to the 2019 U.S. News & World Report “Best Graduate School” rankings. The Center for Health Law Studies has been listed as a top program since the rankings were first published. Four programs in the Richard A. Chaifetz School of Business were ranked in the top 30 this year, including entrepreneurship, international business, supply chain management and accounting. SLU School of Nursing’s master’s program ranked among the top 50 out of more than 500 nursing graduate programs in the country. 1 Health Law 12 Entrepreneurship 13 International Business 15 Supply Chain Management 28 Accounting 28 Part-time Law 50 Best Nursing Programs – Master’s 51 Best Medical Programs – Primary Care 66 Best Nursing Programs – Doctor of Nursing Practice 70 Best Medical Programs – Research 88 Best Law Programs 163 Part-time MBA 194 Top Education Programs Atlas Week Celebrates SLU’s Global Connections The 2018 Sam and Marilyn Fox Atlas Week — “From Broken Walls, We Build Bridges: Out of Conflict Rises Community” — paid special attention to the ways that SLU students, faculty and staff members have forged connections beyond campus to improve the world. The week featured panels, presentations, film screenings, a soccer tournament, and other opportunities to experience the myriad cultures that make up the SLU community. A highlight was the keynote address by brothers Fred and Milton Ochieng’. Fred is pursuing cardiovascular medicine fellowship training at Saint Louis University; Milton is a gastroenterologist with the BJC Medical Group at Progress West Hospital. They spoke of their paths from their Kenyan community Lwala to medical school in the United States and beyond. The pair was orphaned and has used their medical educations to give back to Lwala through the creation of a community health clinic network. The week culminated with the traditional Parade of Nations and the Billiken World Festival. Ring Award Winner Dr. Lauren Arnold, associate professor of epidemiology in the College for Public Health and Social Justice, is the most recent recipient of the Nancy McNeir Ring Award, given by SLU’s chapter of Alpha Sigma Nu to a faculty member who has displayed a special dedication to students. Arnold addressed graduates during Midyear Commencement in December. In her address, she reminded the graduates to find joy in their decisions and to find good mentors Newly Named “Prospect Yards” District Connects SLU’s North and South Campuses In March, members of the Saint Louis University family, SSM Health and the community cast nearly 6,000 votes to name St. Louis’ newest district. The win-ning name? Prospect Yards. The 150-acre district connects SLU’s north and south campuses and is bordered by Laclede Avenue, Chouteau Avenue, Grand Boulevard and Vandeventer and Spring avenues. The district lies within Midtown in the same way that Cortex is part of St. Louis’ Central West End neighborhood and the Loop is part of University City. Prospect Yards includes projects such as the construction of the City Foundry STL and an Element by Westin hotel, as well as redevelopment of the Armory building. The name reflects the area’s early 20th-century roots, when the area west of Grand was known as the “Prospect Industrial District,” one of 17 industrial districts in the city and home to an extensive rail yard and many businesses. The umbrella developer for the larger, 400-acre area is St. Louis Midtown Redevelopment Corporation, which is owned by Saint Louis University and SSM Health. Stephen Sondheim Named 2018 St. Louis Literary Award Recipient The Saint Louis University Library Associates selected Stephen Sondheim, one of the most eminent lyricists and composers of the modern era, to receive the 2018 St. Louis Literary Award. He is the first musical lyricist to win the award since its inception in 1967. Sondheim will come to SLU in October to accept the award. In a career spanning 70 years, Sondheim has writ-ten the lyrics, music or both for some of the most iconic plays in the history of American theater, including West Side Story, Into the Woods, Sunday in the Park with George, Sweeney Todd and Gypsy. The award ceremony and conversation with the author, who will be interviewed by Muny artistic director Michael Isaacson (A&S ’86, Grad CSB ’96), is planned for Oct. 4. For more information, visit lib.slu.edu/about/associates. Med School Residency Program Receives Highest Accreditation Status The Accreditation Council for Graduate Medical Education, the accrediting body for medical residencies and fellowships, granted the School of Medicine continued accreditation, its high-est accreditation status. The status took effect Jan. 24, after a site visit earlier in the month. SLU is the sponsoring institution for 65 residency and fellowship programs at six area hospitals and many other clinical sites. 8.4 Million Gift to Nursing School Abequest gift totaling $8.4 million will allow the School of Nursing to create the Dr. and Mrs. Robert C. Hoppe Endowed Scholarship. The gift — the largest in the School of Nursing’s history and among the largest in SLU’s history — was made by the estate of Mary K. Hoppe (Nurs ’51, Grad Nurs ’59). “The Hoppes’ generosity in providing educational assistance for students will live eternally through the lives of the scholarship recipients and the countless numbers of patients each student touches,” Nursing Dean Dr. Teri Murray (Nurs ’79, Grad Nurs ’93, Grad Ed ’97) said. The nursing school plans to honor Hoppe and her husband, Dr. Robert Hoppe (Med ’51), at its 90th anniversary celebration this fall. Dois

    Universitas: the magazine of Saint Louis University

    No full text
    Fall 2024 issue of Universitas: the magazine of Saint Louis University.FA LL 2024THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSITYUNIVERSITAS THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSITYFALL 22 Three of a Klein Billiken men’s soccer has relied on the Klein family for generations. — by Joe Barker 24 SLU Goes Hollywood A movie based on alum John O’Leary’s life brought a film crew to campus. — by Joe Barker, photos by Sarah Conroy 28 Under One Roof The Catholic Studies Program offers more than a major; it offers community. — by Catherine Kraemer ’ - 6 Paralympic Mettle Dr. Sarah Adam won silver as the first woman on the U.S. Paralympic wheelchair rugby team. — by Bridjes O’Neil 10 Lost and Found Dr. Douglas Boin’s discovery of an ancient Roman temple is making headlines. — by Marie Dilg 14 Join the Club SLU’s sport clubs go beyond traditional collegiate athletics. — by Amy Garland, photos by Sarah Conroy 18 Lighting the Spark Ignite Seminars allow faculty to share their passions with students. — by Amy Garland Members of SLU's rowing club practice on Creve Coeur Lake. PHOTO BY SARAH CONROY FEATURES DEPARTMENT S 2 ON CAMPUS Jon Hamm speaks at commencement Literary Award Campus dog New men s basketball coach Billiken Hall of Fame 31 CLASS NOTES 33 Alumni Spotlight: Sharee (Brown) Silerio (A&S ’09) — by Amy Garland 34 Alumni Merit Awards 37 IN MEMORIAM 41 THE LAST LOOK VOLUME 51, ISSUE 1 EDITOR Laura Geiser {A&S ’90, Grad ’92} ASSOCIATE EDITOR Amy Garland {A&S ’97} ART DIRECTOR Matt Krob ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER Dr. Sarah Adam, SLU assistant professor and Paralympic silver medalist Photo by Sarah Conroy Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address: Universitas DuBourg Hall 39 1 N. Grand Blvd. St. Louis, MO 63103 Email address: [email protected] Website: slu.edu/universitas Universitas is printed by Cummings Printing Worldwide circulation: 127,000 ©2024, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. President’s message Stories that reveal the heart of SLU ASLU faculty member in occu-pational therapy is the first woman in history to compete on the U.S. Paralympic wheel-chair rugby team (page 6). A history professor has made a major dis-covery of an ancient Roman temple (page 10). Numerous faculty members have created new courses designed to ignite a lifelong pro-cess of curiosity and learning in the Ignatian tradition (page 18). And our club sports program offers every student a path to continue — or to discover — an engagement with athletics that supports their well-being, sense of community and con-nection to the natural world (page 14). When I talk to students about why they love Saint Louis University, they often tell me that it is because our commitment to mission is real — that “higher purpose, greater good” is more than a tagline. This issue of Universitas highlights many of the ways that we are delivering on our com-mitment to pursue truth, to re-imagine what is possible and to foster communities where all people thrive. SLU’s Catholic Studies Program is one distinctive example of our Catholic, Jesuit identity in action (page 28). It is a place where students are centered in their spiritual lives, integrating insights from across academic domains as they seek the presence of God in all things. Through numerous gatherings, dis-cussions and events, students can experience what it means to be part of a community that is expressly committed to seeking wholeness. As Billiken alumni, you know well: A SLU education expands our students’ worldviews, the opportunities they will find after gradu-ation and the sense of purpose they will bring to all aspects of their lives. Indeed, our University’s talented alumni continue to tell powerful stories that reflect t he exper iences and t he exper t ise they acquired in their years at SLU. Graduate Sharee (Brown) Silerio (A&S ’09), who worked on the Academy Award-winning documentary short film The Last Repair Shop, is dedicated to creating films that expand representation of Black women and girls (page 33). And alum John O’Leary’s (CSB ’99) story will soon be released asa motion picture filmed in part on our St. Louis campus (page 24). Not all of us will make movies, but we all have an essential role in the Billiken story. In the multiple ways that you contribute to your families, communities and professions — each one of your stories reflects the profound potential of our University’s noble mission. Thank you for continuing to bring SLU’s story to life. Fred P. Pestello, Ph.D. President - - On campus SARAH CONROY CLOCKWISE FROM TOP: A graduate prepares for commencement; graduates celebrate after the ceremony; a group selfe before the ceremony begins in Chaifetz Arena; and the 2024 honorary degree recipients (from left) William and Susan Klepper, Hamm and Christie. SARAH CONROY SARAH CONROY FROM TOP: Hamm (center) receives his honorary degree from Board of Trustees Chair Joseph Conran (left) and SLU He reminded the graduates that they are now for the Society of Jesus; Dr. Susan E. Klepper part of a shared community. (DCHS ’66), emeritus professor at Columbia President Dr. Fred P. Pestello; Hamm poses for a selfe with student speaker Sky Carroll. University; and Dr. William M. Klepper (A&S ’66), academic director at Columbia University. SARAH CONROY 2 UNIVERSITAS / THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y FALL 2024 3 SARAH CONROY KABANCE PHOTO ‘Resilient’ Class of 2024 Celebrated at Commencement For many of Saint Louis University’s newest “Be proud sons and daughters of St Louis,” he alumni — who started college during the said. “Be proud of where you’re from, knowing COVID 19 pandemic — the 2024 spring that it made you. Be at peace with where you commencement was their frst chance to are, knowing it’s transitory and is leading experience a proper graduation. to something else on the path. But most importantly, be excited f St. Louis native and Emmy award-winning or where you’re going actor Jon Hamm congratulated the nearly — the future is endless, it is ripe with possibility, 1,600 students on their ability to thrive. and it is all yours to make of what you wish.” “Your resilience in the face of continued In addition to delivering the main address, discomfort and distraction is impressive,” Hamm joined three SLU alumni in receiving Hamm said. honorary degrees: P. Maria Joseph Christie, S.J. (CSB ’99), secretary of higher education 4 UNIVERSITAS / THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSITY On campus ’ ’ ’ ’ ’ ’ - - - - - - - - - ATHLETICS SARAH CONROY DISTINCTION Class of 2024 University Names New Leadership William Johnson RECTOR AND VICE PRESIDENT, SLU-MADRID Johnson was dean of the SLU School of Law for more than seven years. He served over four years as the director of both the law school’s Center for International and Comparative Law and its Summer Law Program in Madrid. Dr. Twinette Johnson (A&S ’96, GRAD ’19) DEAN, SCHOOL OF LAW Johnson began her academic career as an associate professor at the SLU School of Law over 20 years ago. Most recently, she was dean and professor of law at the University of the District of Columbia David A. Clarke School of Law. Dr. Jackson Nickerson EDWARD JONES DEAN, RICHARD A. CHAIFETZ SCHOOL OF BUSINESS Nickerson was a professor of organization and strategy at the Olin School of Business at Washington University in St. Louis, where he’d been since 2007. JOE BARKER WYLIE AGENCY Hot Diggity! SLU Welcomes Campus Facility Dog The SLU community welcomed a new member to campus this spring: Duo Facility Dog Woody. Unlike a service dog, a facility dog is trained to work with multiple handlers in homes, clinics or organizations and carry out specific,skilled taskswith multiple cli-ents. Facility dogs do not have public access rights and are authorized to work within the assigned facility only. The first Duo Facility Dog to ever go to college, Woody is a two-year-old English Labrador retriever who has been training his entire life for his role: decreasing stress, improving moods and promoting well-be-ing through interactions with students, faculty and staff. KINCAID RECEIVES LITERARY AWARD; WHITEHEAD TAPPED FOR 2025 HONOR Renowned Antigua- Pulitzer Prize-winning author CHRIS CLOSE born author Jamaica Colson Whitehead will come to Kincaid received St. Louis next April to accept the the 2024 St. Louis 2025 St. Louis Literary Award. SLU EARNS NATIONAL FOR ENGAGEMENT The Carnegie Foundation for the Advancement of Teaching announced that Saint Louis University earned the 2024 Community Engagement Classifcation. The elective designation is awarded by Carnegie and the American Council on Education. SLU is one of Billiken Hall of Fame CAMERON NEISLER COMMUNITY The Department of Athletics inducted new members into the Billiken Hall of Fame in February. BILLIKEN GREAT: CONTEMPORARY Honoring student-athletes who competed in the past 30 years Aspen Cervin Ryan McCoy (CSB 17), tennis (CSB 18), swimming Miller Hogan, Alex Nickel (PH 17), baseball softball Jackie Kemph Tim Ream (CSB 10), (CSB ’17, GRAD CSB ’18), basketball soccer Rick Majerus, Jenny (Kehl) men’s basketball Wallace (A&S ’03), head coach soccer head coach for Bi l l iken men’s basketball. S che r t z c ame f rom Indiana State, where he finished his third season with the Sycamores last spring and led them to a 32 7 record and a run to the NIT championship game. Prior to ISU, he spent 13 seasons at Lincoln Memorial, where he led the Railsplitters to 10 NCAA Division II national tournaments, including an appearance in the 2016 NCAA Division II national championship game. Schertz is 403 109 in 16 seasons as a collegiate head coach. His .787 winning percentage ranks in the top 10 among all active coaches in the NCAA. Schertz was named the 2024 MVC Coach of the Year and the Hugh Durham Schertz Heads Up Men’s Basketball J osh Schertz has started his first season as the National Coach of the Year, which is presented annually to the top mid major head coach in college basketball. Literary Award on Whitehead is the author of many 368 campuses DISTINGUISHED ALUMNI AWARD nationwide holding novels, including The Underground the classifcation. Honoring former student-athletes for April 25. Soccer’s Schulte Makes Olympic Team Former Saint Louis University men’s soccer standout Patrick Schulte (CSB ’24) made it to the 2024 Paris Olympic Games as a member of the U.S. Olympic men’s Kincaid’s work Railroad, The Nickel Boys and their contributions to SLU athletics and explores themes of colonialism, Harlem Shufe. In addition to the Pulitzer, he The report distinguished careers gender and sexuality, racism, class won the National Book Award and the Carnegie highlighted SLU’s and family. She wrote the novels Medal for Fiction, among other awards. He work on issues like Tom Strunk (CSB 89), soccer, is chief Annie John, Lucy and See Now Then, has received a MacArthur Fellowship and a food insecurity fnancial ofcer of World Wide and several other books. Guggenheim Fellowship. through Campus Technology Inc. He was instrumental in soccer team. The team advanced to the quarterfinals, Kitchen and bringing Major League Soccer to and Schulte made five appearancesduring the Olympic The new Target store is located along Grand Boulevard between Gratiot and Papin streets. Time for a Target Run TARGET’S NEWEST ST. LOUIS STORE, located near the Saint Louis University campus, opened on July 21. The approximately 72,000-square-foot store includes a CVS Pharmacy, Starbucks Café, and Ulta Beauty at Target. The store flls a void of anchor retail tenants along the Grand corridor and is part of the retailer’s eforts to open more stores that meet community needs for urban centers, dense suburban cities and college campuses. The project is located within the 400-acre redevelopment area that’s guided by the St. Louis Midtown Redevelopment Corp., a joint efort of SLU and SSM Health. Billiken Bounty and community improvement through initiatives like Habitat for Neighborhood Business, SLU Legal Clinics, and the engagement eforts of the St. Louis Midtown Redevelopment Corp. The classifcation has been the leading framework for institutional assessment and recognition of community engagement in U.S. higher education for the past 19 years. FALL 2024 St. Louis and has an ownership stake in St. Louis CITY SC. BAUMAN SPORTSMANSHIP AWARD Honoring individuals who made outstanding contributions to Billiken athletics Joe Conran (A&S ’67, LAW 70) is a retired partner and former chair at Husch Blackwell LLP, where he is of counsel. He chaired the SLU board of trustees for the past 10 years. BOB BURNES AWARD Honoring teams that brought recognition to SLU 2006 women’s soccer team, led by head coach Tim Champion 2011 12 men’s basketball team, led by head coach Rick Majerus tournament. As a Billiken from 2019 to 2021, he was the Atlantic 10 Conference’s Defensive Player of the Year in 2020 and was a first team All Conference pick in 2021. In 2021, he helped the Billikens to a 16 1 4 record and an NCAA quarterfinal appearance. Noted as one of the best young goalkeepers in the country, Schulte was drafted by the Columbus Crew of Major League Soccer in 2022 and helped the team win the MLS Cup in 2023. He was the 2022 MLS NEXT Pro Goalkeeper of the Year in 2022 with Columbus Crew 2. Schulte is one of several Billikens who have been members of the U.S. Olympic men’s soccer team through the qualifying stages, and he joins a select few former Billikens who have represented their coun try in the finals. Brian McBride (Ed ’96) was on the most recent U.S. team to make the finals at the 2008 Beijing Olympics. Matt McKeon (A&S ’97) was on the U.S. squad at the 1996 Atlanta Olympics. Joe Hamm (A&S ’73), Mike Seerey (CSB ’73) and Al Trost (A&S ’71) played on the United States’ 1972 squad at the Munich Olympics. 5 FA LL 2024 7UNIVERSITAS / THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSITY 6 SARAH CONROY DR. SARAH ADAM is an assistant professor of occupational science and occupational ther-apy at Saint Louis University, but her recent achievement is more about making history than teaching health science. Adam became the first woman named to the U.S. Paralympic wheelchair rugby team earlier this year. And in September, that team took silver in the 2024 Paris Paralympic games.Eight teams — including France, Australia, Canada, Denmark, Germany, Great Britain and Japan — competed at the 2024 Paralympics. Adam played a key role for Team USA. She was in the starting lineup when the team kicked off its campaign on Aug. 29 with a 51-48 win against Canada, scoring six times in the victory. In the final match, she and co-captain Chuck Aoki led Team USA with 14 tries. (Tries are worth one point each.) However, Japan won 48-41, claiming gold.USA Wheelchair Rugby (USAWR) announced in May that Adam would be one of 12 athletes to represent the United States at the 2024 Paralympic Games. She was selected from an elite 16-person national training squad competing to earn a spot on the roster.“It’s an honor to be named to a Paralympic team and repre-sent Team USA at the elite level of our sport,” Adam said. “To be the first female to do it, during a time where women in sports is exploding in popularity, just elevates that honor.”PARALYMPICMETTLE– by Bridjes O’NeilA SLU PROFESSOR IS THE FIRST WOMAN TO MAKE THE U.S. PARALYMPIC WHEELCHAIR RUGBY TEAM. Adam’s students and colleagues surprise her with a sign at the Disabled Athlete Sports Association SLU community members cheer for Adam (DASA) Ability Awareness Demonstration in during a watch party for her Paralympic debut April at the Simon Recreation Center. on Aug. 29 in the Allied Health Building. SARAH CONROY SARAH CONROY SARAH CONROY Adam (right) teaches students about wheelchair rugby during the DASA event in April. Although wheelchair rugby has been a mixed-gender sport (with men and women competing together) since it debuted at the 2000 Paralympics in Sydney, the sport has been dominated by men. At the Paralympics in 2021, only four of the 96 athletes were female. That number doubled to eight in Paris. “To be able to compete amongst the best of the best in our sport, par-ticularly as a female playing against mostly men, I have focused a lot on being in peak physical shape,” Adam said. “I spent many hours at the Simon Rec Center getting ready.” Adam had a unique introduction to the sport as an “able-bodied volunteer” for the Disabled Athlete Sports Association (DASA) in 2013, when she was a graduate student. DASA offers the biggest selection of disabled competitive team sports and Parasport opportunities in the SARAH CONROY Adam (center) makes history as the frst woman to compete on the U.S. Paralympic wheelchair rugby team versus Canada in Paris on Aug. 29. Midwest. Adam connected with the community and attended develop-ment events — as both a coach-in-training and a referee. A year later, after noticing difficulty walking, gripping items, numb-ness in her hands and bouts of fatigue, Adam was diagnosed with multiple sclerosis. She began playing wheelchair rugby recreationally in 2017 and competitively in 2019. Adam describes her style of play as “cerebral,” viewing wheelchair rugby as a large chess match, aiming to always be three moves ahead of her opponents. She hopes a documentary about her team’s journey to Paris in 2024 will inspire others and shed light on the adaptive sports movement. Adam (right) shows her Paralympic silver medal to colleague Emma Edwards on her frst day back to campus on Sept. 9. Adam’s medal SARAH CONROY AP PHOTO / MICHEL EULER “I was initially drawn to the combination of physicality and strategy involved in wheelchair rugby,” Adam said. “I’ve found that there is also a great community of athletes in Parasport who support each other not just on the court but off the court. I’ve seen Parasport truly help trans-form people’s lives by connecting them back to some sense of normalcy and a community of like-minded individuals. It’s a great community to be a part of.” Adam made her international debut at the Americas Championship in 2022, where the team won gold, and later that year won a silver medal at the world championships. In 2023, she was part of the gold medal-winning Parapan American Games team that secured USA Wheelchair Rugby a spot for Paris 2024. She also became the first American woman to win Parapan American Games gold in wheelchair rugby. USAWR is the most decorated Paralympic wheelchair rugby program in history and the only one to be awarded at all Paralympic Games since the sport was added to the event roster in Sydney. The United States has won silver medals at the past three Paralympic Games: Rio 2016, Tokyo 2020 and Paris 2024. 8 UNIVERSITAS / THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y FALL 2024 9 FALL 2024 Spello is a picturesque village in Italy where the meandering cob-blestone streets are lined with baskets of flowers. Enclosed in a circuit of medieval stone walls and nestled in the verdant rolling hills of the central region of Umbria, Spello is considered one of the country’s most beautiful villages. The scenery, however, is not what attracted Dr. Douglas Boin to Spello. An expert in the religious transformation of the Roman Empire in the fourth cen-tury, the Saint Louis University history professor was drawn to the village by a piece of stone sitting in a room under a frescoed ceiling and dramatic lighting. The stone contains a rescript, a message from Emperor Constantine giving villagers permission to build a temple in Spello to celebrate a religious festival in their own town rather than making the long journey to another. The only condition was that the temple be dedicated to worshipping Constantine’s imperial ancestors. This rescript was produced at a time when the Roman Empire was straddling the lines between pagan and Christian religions. Over his many years of research into fourth-century antiquities, Boin came across articles and footnotes that mentioned the rescript, which was discov-ered in the 1700s near Villa Fidelia, a resplendent Renaissance home built outside Spello’s walls. “It’s a trophy piece and by far the most famous piece of antiquity to come from Spello,” he said. “It sparked my interest because anytime you can see something written, whether on paper or stone, it can bridge a gap in time and help us make sense of history. So, my colleagues and I decided to take a road trip to see it.” The Latin inscription on the rescript references a temple of opere magnifico, roughly translated as “splendid endeavor.” After seeing the rescript, Boin and colleagues stopped for a glass of wine and began to muse. Where was this splendid temple erected? What did it look like? How did it impress itself on the village at that time? L O S T F O U N D 11 DOUGLAS BOIN The medieval hilltop town of Spello, Italy A SLU history A N D professor's discovery sheds light on the Roman Empire’s transition from pagan worship to Christianity. – by Mar ie Di lg The dig site in Spello, Italy PHOTO BY LUCA PRIMAVESI 10 UNIVERSITAS / THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y PAGA N I SM A N D P LU R A L I SM Boin said the temple is significant because it can offer insights into the social change from pagan gods to Christianity within the Roman Empire. Although Emper

    Universitas: the magazine of Saint Louis University

    No full text
    Summer 2006 issue of Universitas: the magazine of Saint Louis UniversityS i n g i n g g roup wo r k s i n h a r mo n y pg. 9 B i o l o gy fac ult y m a k e t he ir m a r k pg. 12 A l um n i c h a n g e c hil d r e n’s l i v e s pg. 18 B a s e b a l l t e a m p l ay s i n n c a a t our n a me n t pg. 6 F E AT U R E S DE PA R TMEN T S E d i t o r Laura Geiser (A&S ’90, Grad ’92) C o n t r i b u t o r s Allison Babka Burney Marie Dilg (SW ’94) Shannon McGuire (Student Assistant) Rachel Otto “ O n C a m p u s ” n e w s s t o r i e s University Communications Medical Center Media Relations Billiken Media Relations D e s i g n Art Direction: Matthew Krob Universitas is published by Saint Louis University. Opin-ions expressed in Universitas are those of the individual authors and not necessarily those of the University admin-istration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 221 N. Grand, St. Louis, Mo. 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, Universitas. Postmaster: Send address changes to Universitas, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html Universitas is printed by Universal Printing Co. and mailed by Specialty Mailing. Worldwide circulation: 111,720 © 2006, Saint Louis University All rights reserved. Volume 3 2 , I ssue 3 In April, I had the privilege of speaking to a group of outstanding local citizens to accept St. Louis’ 2005 “Citizen of the Year” award, which is presented by a committee of former recip-ients and sponsored by the St. Louis Post-Dispatch. It was truly an honor. The humbling experience gave me the oppor-tunity to reflect on my early days in my adopt-ed hometown and how much I have seen things change here during the last 19 years. Although I had a very brief visit to St. Louis in 1967 on my way to Mexico to hone my Span-ish skills, I didn’t spend any time in the city until I was named to Saint Louis University’s board of trustees in 1983. On my first trip to SLU for a board meeting, I extended my stay so I could see the city. After taking the Lindell Boulevard bus downtown on a Saturday after-noon, I found so little to do that I caught an earlier flight back to Chicago. For four more years, I came to St. Louis for the trustees’ quarterly meetings — and I came only for the meetings. Then, in 1987, when I was elected president of SLU, I decided that I had to get to know the city. One Sunday morning shortly after my arrival, I took former SLU President Tom Fitzgerald’s old, green-colored Oldsmobile and drove around downtown, trying to memorize the street names. I saw progress. In four years, some things had certainly changed for the better. But as I drove back to campus, I saw that there was still much to do. Right in Midtown, in my own new back yard, there were dilapidated buildings, plots of asphalt and rundown city blocks. In my early days at SLU, I was like a new homeowner. I wanted the best for my neighborhood, and I was willing to make the effort to improve it. When I came to this city to live and work, I quickly adopted it as my home. But I still needed a shot of hometown pride. I found that pride away from buildings and ball clubs. I love St. Louis for more than its Arch, toasted ravioli and Ted Drewes frozen custard. I love it for the people who are trying to make a dif-ference — visionaries such as Joe Edwards and Richard Baron and many others. And while I did use my “Citizen of the Year” acceptance speech as an opportunity to challenge my fellow St. Louisans to aspire to make our city greater, I also know that I — and our University — have enjoyed unprec-edented cooperation from city officials and local business leaders. I can remember being here for just a few months and working with then-mayor Vince Schoemehl (Grad ’86) to get trees — substantial trees — planted along Grand and Lindell. In Chicago, I would have never had as much direct access to the Board of Aldermen or to the mayor himself. Today, we continue to receive tremendous support from Mayor Francis Slay (Law ’80) and from the Board of Aldermen. I am truly grateful for the trust that city officials have always placed in SLU. And it’s not just the civic leaders who have given us their trust. You, our alumni, friends and do-nors, have shown how you believe in us, too. Through your gifts of time, talent and treasure, you’ve been instrumental in building the reputation and stature of Saint Louis University. We’ve come a long way together. And the city of St. Louis has, too. I am so thankful for your commitment to Saint Louis University and hope that — no matter where you live now — SLU and St. Louis will always feel like home. Lawrence Biondi , S. J . photo by Steve Dolan President’s Message etrolink On the Map A special insert gives you an up-close look at SLU’s campus. Map Illustration by Robert North Jr. U N I V E R S I TA S S UMME R 2 0 0 6 Fr. Biondi with Dr. Donald Suggs, publisher of the St. Louis American and the 2004 Citizen of the Year. 2 On Campus Arena plans taking shape Research Building gets a name Commencement U.S. News ranks SLU high again Social justice magazine debuts 6 Billiken News Baseball team goes to the NCAA Tournament Walker is now a coach 7 Campaign Update Meet Anna and Jesse, students doing their part for annual giving 22 Class Notes Catch up with classmates 28 In Memoriam Remembering those members of the SLU community who recently died 29 Off the Shelf Seven books from the SLU community 30 Alumni Events Find SLU alumni activities wherever you live 32 Perspective An alumnus turns from music fan into record label owner 33 The Last Word Letters to the editor 9 Brothers in Song An introduction to the Bare Naked Statues, SLU’s all-male a cappella group. By Allison Babka Burney Bio-Diversity The biology department faculty are studying everything from fish to wasps to liver cancer. By Marie Dilg A Haven of Hope Two alumni have created a home where abused and neglected children thrive. By Marie Dilg 12 18 Students congregate around a fountain at the Medical Center on a hot June aftternoon. Photo by Kevin Lowder U N I V E R S I TA S w w w. s l u . e d u U N I V E R S I TA S S UMME R 2 0 0 6 Groundbreaking is less than three months away for the new 80.5millionSaintLouisUniversityArena.AtitsMaymeeting,theUniversitysboardoftrusteesgavetheauthorityforgroundbreakingtotakeplacebySeptemberfortheoncampus,multipurposeArena.AlsoinMay,SLUannouncedthatSt.LouisbasedClaycohasbeenchosentobuildtheArenaontheeasternendofcampus.Claycowilloverseeconstructionofa10,600seatbasketballArena,apracticefacilityandathleticdepartmentofficesandsupportfacilities.TheArenawillbehometoBillikenmensandwomensbasketballaswellasconcerts,familyshows,tradeshows,commencementsandmanyotherevents.PhiladelphiabasedGlobalSpectrumhasbeenselectedtomanagetheArenaandassistinpreopeningactivities.TheArenawillbefundedthroughfundraising,80.5 mil-lion Saint Louis University Arena. At its May meeting, the University’s board of trustees gave the authority for groundbreak-ing to take place by September for the on-campus, multipurpose Arena. Also in May, SLU announced that St. Louis-based Clayco has been chosen to build the Are-na on the eastern end of campus. Clayco will oversee construction of a 10,600-seat basketball Arena, a practice facility and athletic depart-ment offices and support facilities. The Arena will be home to Billiken men’s and women’s basketball as well as concerts, family shows, trade shows, commencements and many other events. Philadelphia-based Global Spectrum has been selected to manage the Arena and as-sist in pre-opening activities. The Arena will be funded through fund raising, 8 million in TIF funding and bonds, which will be paid off with revenues from the Arena. Fund raising continues toward the 39 million goal for the Arena project. Alumni and benefactors who would like to contribute to the Arena project can get information about the project online at arena.slu.edu, or by calling (314) 977-2499. Site preparation will begin this summer, with a groundbreaking date in late August or early September. Construction is expected to take approximately 19 months and be completed in March 2008. At 10,600 seats, the Saint Louis University Arena will have the second largest capacity in the Atlantic 10 Conference. The University anticipates hosting more that 90 events in the Arena in its first year of operation, with roughly half being non-University events. Arena plans move forward; groundbreaking soon Commencement 2006 Saint Louis University celebrated commencement for more than 1,700 graduates May 20 at Savvis Center. Chris Lowney, author of Heroic Leadership: Best Practices from a 450-Year-Old Company that Changed the World, delivered the com-mencement address. The book takes the pil-lars of Ignatian teachings and applies them to today’s business environment. In addition to Lowney, other honorary degree recipients were Maurice B. McNamee, S.J. (A&S ’33, Grad ’34, ’45), professor emeritus of Eng-lish, professor emeritus of art and art history and director emeritus of Samuel Cupples House; and Frank Stroble (Cook ’52, Grad ’60) and Ruth Stroble, longtime supporters of Catholic higher education and commu-nity volunteers. Throughout five decades as a professor at Saint Louis University School of Medicine, Dr. Edward A. Doisy was renowned worldwide for his pioneering work in the field of biochemistry, including win-ning the 1943 Nobel Prize for discovering the chemical nature of vitamin K. To honor his lifetime of work, SLU’s new biomedical research tower, a 67 million fa-cility, will be named the Edward A. Doisy Research Center. The Doisy family has com-mitted 30millionforconstruction.TheannouncementwasmadeduringaspecialtoppingoutceremonyJune9,duringwhichthebuildingsfinalsteelbeamwassecuredinplace.Faculty,staffandstudentswereinvitedtosignthebeambeforeitwasliftedtothetopofthestructure.TheceremonyalsofeaturedtheannouncementofseveralothermajorgiftstosupportboththeresearchbuildingandresearchattheSchoolofMedicine:30 million for construction. The announcement was made during a special topping-out ceremony June 9, dur-ing which the building’s final steel beam was secured in place. Faculty, staff and students were invited to sign the beam before it was lifted to the top of the structure. The ceremony also featured the announce-ment of several other major gifts to support both the research building and research at the School of Medicine: • 2 million to establish the James B. and Joan C. Peter Endowed Chair in Biochemistry and Molecular Biology. Dr. James B. Peter (Med ’58) is founder and former chief execu-tive officer of Specialty Laboratories, a hospi-tal- focused clinical reference laboratory. • 2 million to establish the Badeeh A. and Catherine V. Bander Endowed Chair in Ne-phrology. Dr. Steven J. Bander (A&S ’75), adjunct faculty member in nephrology, and his wife, Patricia, are endowing the chair in honor of his parents. • 1.5 million in a challenge grant from the J.E. and L.E. Mabee Foundation to sup-port construction of the research building. The building is expected to open in fall 2007. For more details, visit researchbuild-ing. slu.edu. Research building gets name and 30 million gift For the third consecutive year, U.S.News & World Report has named the Saint Louis University School of Law’s health law program the best in the na-tion. Since the rankings for the health law specialty began a decade ago, Saint Louis University’s Center for Health Law Studies never has been out of the top three. Overall, the magazine’s “Best Graduate Schools 2007” issue ranked the law school among the nation’s 180 accredited law schools. The School of Medicine was ranked No. 62 among the nation’s 144 research-intensive medical schools surveyed by U.S. News. The school’s geriatrics program was ranked 12th in the United States. In addition, the part-time MBA program in the John Cook School of Business was ranked No. 25 in the nation out of 347 part-time MBA programs accredited by the As-sociation to Advance Collegiate Schools of Business (AACSB). Graduate programs honored by U.S. News again Annual Atlas Week recognizes the University’s world view Through more than 50 special events, including discussions, open houses and student presentations, Atlas Week 2006 gave the Saint Louis University community the opportunity to ex-plore the international dimension of SLU’s academic programs and celebrate the University’s role in international education and service. The theme of this year’s Atlas Week, held in April, was “Political and Social Justice in a Global World.” The Signature Symposium featured Nobel Peace laureate Jody Williams, who led the passage of the international treaty banning antipersonnel landmines. Another highlight was a panel discussion commemorating the first anniver-sary of the death of Pope John Paul II. The Billiken World Festival, which featured a Parade of Nations, international cuisine, music, games and informational booths in the quadrangle, wrapped up the week. In SLU’s residence halls Students living on campus during the 2005-06 school year On-campus rooms Residence halls: Clemens, DeMattias, Fusz, Griesedieck, Marguerite, Notre Dame, Reinert and Walsh Apartment complexes: Grand Forest, the Language Houses, Marchetti East and West, and the Village Apartments 3,346 1,785 84 Severson wins teaching award Dr. John G. Severson Jr., professor of biology, received the 41st an-nual Nancy McNeir Ring Award from Alpha Sigma Nu, the Jesuit honor society. It is SLU’s oldest student-initi-ated teaching award and is named for the University’s first dean of women. Severson joined the faculty in 1971, has served as associate dean of the College of Arts and Sciences and led the Academic Services Center from 1993-2001. He played an in-tegral role in the development of the Pre- Law and Pre-Med Scholars programs, as well as SLU 101 and SLU 301 programs for new students. A view of the Arena facing northwest. A student shows her pride during the Parade of Nations. From left: The Strobles, McNamee and Lowney. Signing the beam before it is raised (from left): Alderman Michael McMillan; AT&T-Missouri vice president Debra Hollingsworth; U.S. Senator Christopher “Kit” Bond; Clayco president and SLU trustee Bob Clark; University President Lawrence Biondi, S.J.; SLU trustee Charles Drury and Shirley Drury, donors to the project. Photo by Kevin Lowder Photo by Clayton Berry Photo by Allison Babka Burney Photo by Allison Babka Burney Lincoln Legacy exhibit coming to SLUMA From Aug. 25-Dec. 17, Samuel Cupples House, in partnership with the Saint Louis University Museum of Art, will present “The Lincoln Legacy: Presidential Years.” The exhibit, which will be in the Judith and Adam Aronson Gallery at SLUMA, showcases the Dr. Bernard Hall Abraham Lincoln Collection of the University of Saint Mary in Leavenworth, Kan. It will feature manuscripts and autographed documents, as well as sig-nificant historical artifacts relating to Lincoln’s presidency. The exhibit is free and open to the public. In conjunction with “The Lincoln Legacy,” the University will be the site of a Civil War re-enactment, the “Camp Jackson Historic Encampment,” during Labor Day weekend, Sept. 1-3. For other programming and updates, visit http://lincoln.slu.edu or call (314) 977-2666. t h e A R T S a t S L U Hand-tinted woodcut of Lincoln (1863). MOCRA welcomes back ‘Silver Clouds’ They’re back! SLU’s Museum of Contemporary Religious Art (MOCRA) announces a final show-ing of its most popular show ever, Andy Warhol’s “Silver Clouds.” First shown at MOCRA in 2001 and 2002, the largest-ever U.S. “Clouds” instal-lation features dozens of silver mylar balloons riding the air currents around MOCRA’s capa-cious nave gallery. Visitors are invited to enter into a childlike world of wonder and experience one of Warhol’s groundbreaking experiments with creating unique, non-traditional environ-ments. MOCRA also will be showing a number of Warhol’s “Sunset” prints. The “Clouds” open in mid-September and continue through the fall semester. Call MOCRA at (314) 977-7170 or visit mocra.slu.edu for more information. “Silver Clouds” fill the gallery during the 2002 MOCRA showing. New administrators join SLU As of July 1, Dr. Kent Porterfield is Saint Louis University’s new vice president for student development. Porterfield comes to SLU from Northwest Missouri State Univer-sity, where he was vice president for student affairs — a role he held for nearly a decade. At SLU, Porterfield fosters student formation through non-academic areas, including residence life, student life, student health and counseling, campus recreation and community outreach. He also oversees contracted services such as the bookstore and dining services. At Northwest, Porterfield led many of these same areas and worked to enhance students’ lives. Dr. Connie Evashwick, previously an endowed chair and director of the Center for Health Care In-novation at California State University, Long Beach, joined SLU as dean of the Saint Louis University School of Public Health on July 1. Over the years, she has combined her academic career with consulting and direct operations management. Evashwick has served as vice president of long-term care for two major health care systems and is a national consultant to health systems, hospitals and long-term care organizations. She is the author or editor of 12 books and more than 100 other publications. News Briefs Saint Louis University again opened its doors to the area’s homeless population to provide a hot meal and clothing. During SLU’s annual “Open Doors” event March 23, hundreds of homeless individuals also received free employment and housing assistance, legal services and opportunities to pursue literacy education. SLU President Lawrence Biondi, S.J., and Dr. Ellen Harshman (Grad ’78, Law ’92), dean of the John Cook School of Business, were named to the St. Louis Business Journal’s “Influentials” list this spring. The list recognizes area business and community leaders who make a difference to the region. Biondi was honored as one of 10 “legends” — individuals “who have gone beyond being influential to become legends in our region and beyond.” Dr. Bruce R. Bacon, professor of internal medicine and director of the division of gastroenterology and hepatology at the School of Medicine, has been appointed to the National Commission on Digestive Diseases, an institute of the National Institutes of Health and the National Institute of Diabetes and Digestive Diseases. The commission, comprising 16 people, is charged with conducting an overview of research in digestive diseases and developing a strategic plan for the next 10 years of NIH digestive disease research. Saint Louis University Provost Dr. Joe Weixlmann was named “Distinguished Editor of the Year” by the Council of Editors of Learned Journals. The award recognizes Weixlmann’s dedication and excellence in his work with African American Review, the official publication of the Modern Language Association’s Division on Black American Literature and Culture. He was editor in chief from 1976-2004. The St. Louis Jesuits, sometimes called “the fathers of contemporary American liturgical music,” received an honorary doctorate of music from Creighton University this spring. Roc O’Connor S.J. (A&S ’73), Bob Dufford S.J. (A&S ’67, Grad ’72, ’75), John Foley S.J. (A&S ’68, Grad ’68, ’74), and Dan Schutte (A&S ’72), who were featured in the fall 2005 Universitas, were recognized for their 30 years of ministry to the Church. U N I V E R S I TA S w w w. s l u . e d u U N I V E R S I TA S S UMME R 2 0 0 6 Community service tops 750,000 hours Members of the Saint Louis University community continue to live the institution’s mission as 14,602 students, faculty and staff contributed 753,808 hours of com-munity service and outreach during 2005, according to a recently released University report. This is the second year in a row that members of the University have performed more than 750,000 hours of service. According to the report, more than 1,270 organizations and events benefited from SLU faculty and staff volunteerism, up from 1,110 in 2004. Faculty and staff spent 71,903 hours performing community service in 2005, a drastic jump from 41,533 hours previously. Student service also is intensive. Through academic courses, internships and campus organizations, students committed more than 76,768 hours to outreach. SLU students spend spring break in service During spring break in March more than 50 Saint Louis Uni-versity students participated in rebuilding efforts in New Orleans. Of the group, 39 SLU students assisted Ser-vice International with the demolition of buildings that were flooded or destroyed by Hurricane Katrina. After demolition, the students helped with power washing, sanitizing and rebuilding efforts. Another 15 SLU students worked with Operation Helping Hands, where they helped remove debris in neighborhoods and assisted with light carpentry, as well as construction and restoration of homes and buildings. This year, about 150 SLU students partic-ipated in spring break mission trips not only to New Orleans, but other U.S. locations as well as sites in Mexico and El Salvador. Social justice magazine debuts on campus Current SLU students from various cross-cultural and social justice groups on campus have collaborated to produce a student-led, student-run magazine that aims to raise aware-ness about international social justice issues. Based upon the Jesuit mission, One World focuses attention on men and women around the world who are in dire need of help. Whether it’s poverty and starvation in the developing world or genocide in Sudan, SLU stu-dent writers explore humanitarian issues in an effort to make read-ers realize that they have capacity and responsibility to get involved. To view the magazine online, visit www.sluoneworld.com. Or to order a copy of the 40-page magazine, send your request and 5 contri-bution to: One World c/o Donna Bess; Busch Student Center, Suite 237; 20 N. Grand Blvd.; St. Louis, MO 63103. Make checks payable to Saint Louis University. AHarvard University team recently won the Urban Land Institute Gerald D. Hines Student Urban Design Competition, which was held March 31 at Saint Louis Univ

    Universitas: the magazine of Saint Louis University

    No full text
    Fall 2001 issue of Universitas: the magazine of Saint Louis UniversityT H E M AG A Z I N E O F S A I N T L O U I S U N I V E R S I T Y F A L L 2 0 0 1 By Lawrence Biondi, SJ Saint Louis University President The following is an excerpt of a message I sent to the Saint Louis University community in the days immediately following the terror-ist attacks that shook our nation on September 11. Like all Americans, I was deeply troubled by the events of that day and have been mourning the loss of lives, freedom and innocence throughout the difficult weeks that have followed. I also have been praying. In that regard, I have not been alone. Like so many across the country, the SLU community gathered for Masses, memorials and vigils that allowed us to contribute our prayers to the healing of our nation. What I have taken away from these prayers, both public and pri-vate, is the importance of tolerance and the hope for peace. Please keep our faculty, staff and me, and, most of all, the young people we guide and protect, in your thoughts and prayers. The unthinkable has happened: Terror has struck us at home. The events on September 11 and the after-math in New York and Washington, D.C., are horrific. These events have been almost beyond our ability to comprehend as Americans and as human beings. As the smoke and rub-ble cleared, as the faces and stories of people who lost their lives in this vio-lence flashed across our televisions, as we continue to watch this human tragedy unfold, our shock gives way to anger. Our shock and anger spark so many questions: How could this happen to us? Why didn’t “they” stop this from happening? Who did this? Although no group has claimed responsibility, many are assuming that these murder-ers came from the Middle East and were supported by Middle Eastern countries. As our nation’s law enforce-ment agencies continue their investi-gations, there has been an alarming backlash against innocent members of our community simply because they are Muslim or Arab or “look” as if they are from the Middle East. It is important for us to remember that there is evil in our world: There are evil persons in every country, in every reli-gion, in every culture. It is important for us to remember that no ethnic or religious group should suffer as a whole for the malicious actions of a few. During this difficult time and all the days ahead, I pray that the Holy Spirit will enlighten us with God’s understanding and tolerance. At Saint Louis University, as members of a diverse educational community shaped by Catholic and Jesuit heritage and values, we must not simply practice but also promote tolerance and understanding. I was sent the following comments from SLU professor Dr. Steven Fliesler who received them second-hand from a New Yorker who is also a Muslim. Perhaps they will shed light on the misguided notion terrorism is inherent to Islam: “Truly, the taking of innocent lives or the act of suicide are forbidden in Islam. Only God can take the life of a human when the time comes. To use one’s own body as a means of suicide or to kill innocent people is an act of violence against humanity. A definition of a ‘Muslim’ simply means to submit the human will to the will of God, the creator and sustainer of all of mankind. The term ‘jihad’ has been unfortunately defined as ‘holy war,’ when there is no such term in the Muslim Holy Book. The term ‘jihad’ means ‘struggle,’ and the greatest strug-gle is the struggle with one’s inclination to sin. Provisions are given for one to defend oneself in combat when attacked, not cowardly acts on inno-cent lives. I pray for those who died in this catastrophe. The media in New York tried to blame the act on ‘Muslims,’ but Mayor Giuliani voiced that whoever the perpetrators were or are will be found and punished. He further added that no single group should be blamed for this.” The cries for revenge for the acts of terrorism on September 11, especially those that focus on Muslims and Arabs, bring to mind the treatment of Japanese Americans following the attack on Pearl Harbor. I sincerely hope — more than 50 years later and faced with another unthinkable attack — that no similar mistreatment will be brought to bear upon Arabs or the followers of Islam, at Saint Louis University, the United States or our world. This is a time to stand together as Americans and as a peo-ple of faith. The perpetrators of the horrific acts on September 11 must be identified in accordance with our nation’s laws so that justice will, in fact, be done. This is best left to the appropriate intelligence and law enforcement agen-cies. If we allow ourselves to give in to our pain and anger, then we allow the terrorists to win. If we act out against innocent people to fulfill our need for revenge, we are no better than the terrorists. If we allow bigotry and hatred to consume us, the terrorists will ultimately succeed in destroy-ing all that we as Americans hold true. UNIVERSITAS Volume 28, No. 1 Editor Laura Geiser (A&S ’90, Grad ’92) Contributors Clayton Berry Jaime Daniels (AHP ’99, ’01) Marie Dilg (Soc Ser ’94) John Vieth Chris Waldvogel Photo Credits Steve Dolan, 19-22 Dave Preston, 25, 31 Steve Schremp, inside cover John Vieth, cover, 17, 32 James Visser, 4, 11-13 Chris Waldvogel, 2-5, 15-16 Design AKA Design Inc. Art Direction: Richie Murphy Design: Stacy Lanier UNIVERSITAS is published quarterly by Saint Louis University. Opinions expressed in UNIVERSITAS are those of the individual authors and not neces-sarily those of the University adminis-tration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publica-tion should indicate that fact. The editor reserves the right to edit all items. Please address all mail to UNIVERSITAS, DuBourg Hall 39, 221 N. Grand, St. Louis, MO 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, UNIVERSITAS. Postmaster: Send address changes to UNIVERSITAS, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html UNIVERSITAS is printed by Universal Printing Co. and mailed by Accurate Business Mailers Inc. Worldwide circulation: 106,000 © 2001, Saint Louis University. All rights reserved. On the Cover: Flags were placed around the statue of St. Ignatius Loyola, located behind DuBourg Hall, following the events of Sept. 11. IIN MEMORIIAM AALLUUMMNNII nnootteess 2 23 32 28 30 FALL 2001 C O N T E N T S 6 A Man for Others Remembering the life of Father Paul C. Reinert, S.J. 10 America 101 When international students arrive at SLU, they receive a thorough orientation. 14 You Were Here New University maps show just how much SLU has grown. 18 Faith Healing Is there really a connection between prayer and healing? 2 SLU named a ‘best buy’ for the 4th straight year For the fourth consecutive year, U.S. News & World Report has named Saint Louis University as one of the best education values in the United States. According to the report, SLU ranks among the top 50 national, doctoral universities on the “Great Schools at Great Prices” list. “Saint Louis University offers students the resources of a leading research university with the personal attention that a Jesuit education pro-vides,” said University Provost Sandra Johnson (A&S ’73). “We are one of only three Catholic universities included on this list.” U.S. News also ranked Parks College of Engineering and Aviation among the top 26 undergraduate engineering programs in the nation, with Freshmen boast higher test scores New undergraduate stu-dents again have con-tributed to the healthy size of the Saint Louis University stu-dent body. New freshmen and transfer students total approxi-mately 1,700 for the new acad-emic year. “SLU continues to attract quality students from around the nation,” said assis-tant provost Ned Harris. “At the same time, we have main-tained our allure for — and allegiance to — potential col-lege students from the metro-politan area.” The quality of SLU’s incoming students also continues to rise. This year’s new freshman posted an aver-age ACT score of 26.4, an increase from last year’s class average of 26 and the highest on record for the University. Continental plans a comeback One of St. Louis’ architec-tural gems soon will shine in the skyline again thanks to the ongoing reno-vation of the Continental Building, located on Olive Street near Grand Boulevard. Saint Louis University played a vital role in the building’s redevelopment, providing a critical 1.5millionloanatatimewhendeveloperStevenTrampewashavingtroublesecuringfinancing.Planscallfortransformingthehistorictreasureinto106apartmentswitharestaurantandparkinggarage.Constructedin1930,theContinentalBuildinghashousedmanynotabletenants,includingamoviestudioandseveralautomakers.Thereareanumberofurbanlegendsconnectedwiththelandmark,includingthemyththatitwasusedastheskyscraperintheSupermantelevisionseries,whichiswhyitssometimescalledtheSupermanBuilding.Endowmentratedinnationstop50ResultsfromanindepthstudyconductedbytheNationalAssociationofCollegeandUniversityBusinessOfficersranksSaintLouisUniversitysendowmentthirdamongCatholicschoolsinthecountryasofJune30,2000.AmongCatholicinstitutions,onlyNotreDameandBostonCollegehadlargerendowmentsthanSLU,whichranked49thoverallamong569participantsforthestudy.NACUBOlistsSLUsendowmentat1.5 million loan at a time when developer Steven Trampe was having trouble securing financing. Plans call for transforming the historic treasure into 106 apartments with a restaurant and parking garage. Constructed in 1930, the Continental Building has housed many notable tenants, including a movie studio and several automakers. There are a number of urban legends connected with the landmark, including the myth that it was used as the skyscraper in the Superman television series, which is why it’s sometimes called the Superman Building. Endowment rated in nation’s top 50 Results from an in-depth study conducted by the National Association of College and University Business Officers ranks Saint Louis University’s endowment third among Catholic schools in the country as of June 30, 2000. Among Catholic institu-tions, only Notre Dame and Boston College had larger endowments than SLU, which ranked 49th overall among 569 participants for the study. NACUBO lists SLU’s endow-ment at 925.9 million, an 18.1 million increase from its 1999 mark. PERMANENT LANDING: A former plane from the fleet of training aircraft for Parks College of Engineering and Aviation has found a new home at the west side of McDonnell Douglas Hall. The Cessna 310 was retired due to its age. the department of aerospace engineering in the top three nationally. Both rankings have moved up and are for schools where the highest degree offered is a master’s. 10 medical fields cited by U.S. News The 2001 edition of U.S. News & World Report’s “America’s Best Hospitals” places Saint Louis University Hospital among the top 50 medical centers in treatment for the following disorders and diseases: digestive disease (29); ear, nose and throat (29); geri-atrics (7); heart (23); hormonal disorders (26); kidney disease (33); orthopedics (32); respira-tory (25); rheumatology (33); and urology (40). “For us to have these programs nationally ranked reflects well for our hospital and its medical staff partner, the School of Medicine,” said Dr. Gary Peterson (Med ’73), president of the Saint Louis University Hospital medical staff and pro-fessor of surgery. “Most of all, it reflects well on our patients and the care we provide them.” U.S. News assessed hospital care for 17 specialties at 1,878 hospitals nationwide, up from 1,701 last year. NEWS BRIEFS By The Numbers 21.4 Percent of freshmen who are children of Saint Louis University alumni. 762 Fireworks shells launched during the display for September’s Alumni Reunion Weekend. 2,046 Hot dogs and hamburgers consumed during Reunion Weekend. 15,224 Attendees at events spon-sored by SLU’s office of alumni relaions between July 2000 and June 2001. Dr. Anne Perry (Grad Nurs ’76), professor at the School of Nursing, has received her profession’s highest honor — induction as a fellow into the American Academy of Nursing. She is one of only a handful of nurs-es and nurse educators in the area to achieve this status. … Vice President for Facility Services and Civic Affairs Kathleen Brady (A&S ’76) received the George D. Wendel Civic Leadership Award from the Student Government Association this spring. The award, created in 1999, is named after the late Dr. George Wendel, a long-time member of SLU’s faculty and a leader in civic progress. … Three plays remain in Saint Louis University Theatre’s line-up for 2001-02: Tartuffe, Nov. 9-11 and 16-17; Godspell, Feb. 15-17 and 21-23; and The Crucible, April 19- 21 and 26-27. For tickets, call (314) 977-2998. … SLU trustee Kim Tucci (A&S ’62, Grad ’69) has been named chairman of the St. Louis Convention and Visitors Commission by Gov. Bob Holden. Tucci, president and co-owner of the Pasta House Co. restaurants, is chairman of the Billiken Club and the Missouri Film Commission. … Provost Sandra Johnson (A&S ’73) received the inaugural William J. Curran Distinguished Public Health Service Award from the American Society of Law, Medicine and Ethics in recognition of her work in the area of legal and policy issues in treatment for pain. … Simon Schama, the award-win-ning historical author, will receive the 2001 Saint Louis Literary Award from the Associates of Saint Louis University Libraries at a presenta-tion Tuesday, Oct. 30, on campus. A professor of history at Columbia University, Schama specializes in European cultural and environmen-tal history and the history of art. His books include A History of Britain, Citizens, Patriots and Liberators, The Embarrassment of Riches and Landscape and Memory. He also has been an art critic for The New Yorker. PEOPLE PROJECT: Two figures, “The Billiken” by Brent Morris (right) and “Satchmo Plays the Saint Louis Blues” by Scott C. Clark, were on display on campus along Grand Boulevard all summer thanks to the city’s “People Project,” a region-wide temporary public art exhibit similar to Chicago’s “Cows on Parade.” The People Project featured approximately 250 figures dis-played at locations around the St. Louis area. WBCA recognizes women hoopsters The Saint Louis University women’s basketball team has been honored as a 2000-01 Academic Top 25 Team by the Women’s Basketball Coaches Association. As a team, the Billiken women’s basketball squad posted a cumulative 3.31 grade point average last season, which ranked eighth among all Division I teams. “This award confirms the outstanding work and effort our ladies put forth all year long,” said head coach Jill Pizzotti. “The team is com-mitted to reaching its potential both on the basketball court and in the classroom. I am extremely proud of them for earning this award and pleased with the national recognition they received from the WBCA.” This marks the sec-ond time in three seasons that the women’s team has been recognized by the WBCA. project last year. The University formed a Web team, created an advisory council of students, faculty and staff, and conducted sur-veys to get input on the new site’s content and look. The result? A new site full of use-ful information, news stories and photos. To see for your-self, visit www.slu.edu. SLUCare leader now on board Daniel G. Zabel has joined Saint Louis University in the newly created position of executive director of the University Medical Group, more commonly known as SLUCare. He was selected fol-lowing a national search that commenced in February. Since 1996, Zabel had been the executive director and chief executive officer of the University Physicians of Brooklyn at the SUNY Health Sciences Center in Brooklyn, N.Y., where he also held an appointment as associate clinical professor in the departments of medicine and surgery. Prior to that, Zabel held executive positions with the University of South Florida Physicians Group, Tampa General Hospital, the University of Florida Health Sciences Center and the University of Connecticut Health Sciences Center. SLU’s Web site gets a facelift Saint Louis University has a new presence online. After months of work and significant input from the University community, the new www.slu.edu arrived on the World Wide Web Sept. 1. Because the Internet has become the primary research tool of prospective students and a popular way for par-ents, alumni and others to gather information, SLU began a Web re-engineering 4 Parks profs team up with NASA Saint Louis University is among a select group of institutions charged with reviewing concepts for com-mercial spacecraft for NASA. As part of its involvement in NASA’s newly formed Integrated Technology Assessment Center, SLU has received a one-year 100,000 grant in what’s expected to be a three-year $400,000 agreement. A research team at Parks College of Engineering and Aviation will examine the concepts and make recommendations to NASA. Paul Czysz (Parks ’55), a professor of mechani-cal and aerospace engineer-ing, heads the team, which includes SLU professor Chris Rahaim and students. “This is not science fiction,” Czysz said. “I have believed for more than 40 years that fre-quent flights to space are pos-sible.” So possible, he added, that Saint Louis University is offering two concepts of its own. Miss Teen USA is a Billiken-to-be The newly crowned Miss Teen USA will extend her reign to Saint Louis University. Marissa Whitley earned the crown Aug. 22 in South Padre Island, Texas, at the 19th annual Miss Teen USA competition. A native of Springfield, Mo., the 18- year-old Whitley plans to pursue communication or criminology when she attends SLU next spring. She is a Calloway Scholar, an honor given to the top African- American students accepted to SLU. SKY LIGHTS: For the second year, fireworks lit up the campus in September for Alumni Reunion Weekend. More than 1,700 came back to SLU for class celebrations, the homecoming parade, barbecues, family events, a men’s soccer game and tram tours. Grand and Lindell buildings acquired Saint Louis University has purchased the Marina Building, 300-312 N. Grand Blvd., and the Feathers Building at 3559 Lindell Blvd., which houses Vito’s Pizza and 17 efficiency apartments. “Investing in the neighborhoods sur-rounding SLU is essential,” said University President Lawrence Biondi, S.J. “The University will continue its efforts in developing our campus and helping revitalize our city.” Along with the Bills keep C-USA award streak alive Conference USA has named Saint Louis University as its recipient of the Institutional Excellence Award for the sixth consecu-tive year. The award is given to the school with the highest cumulative grade point average vacant Jack in the Box restau-rant at Olive and Grand — which the University pur-chased in December — the two properties give SLU con-trol of the south entrance to the arts and entertainment district known as Grand Center. “It is our hope to attract restaurants and stores to enhance Midtown for our students, employees and the community,” said Kathleen Brady (A&S ’76), vice presi-dent for facilities management and civic affairs. Whitley Marina Building Lecture series honors Campbell The department of com-munication sciences and disorders has begun a memori-al lecture series on topics in diversity in honor of Dr. Lynda R. Campbell, who died in March. The first lecture was held in October. The next lecture will be Nov. 2 and 3, when Dr. Fred Hall presents “Educational and Classroom Issues in Multiculturalism.” The lectures are open to all. For reservations, call (314) 977-2939. Campbell, whose research and teaching focused on multiculturalism, was an associate professor and the past chair of the department. 30 The September-October 1971 issue of Saint Louis University Magazine featured a photo essay of Tegeler Hall, the then-new home of the School of Social Service. The issue also included the results of an alumni survey intended to compare attitudes of the classes of 1935, ’55 and ’69. Among the findings: Sixty-nine percent of the class of ’69 favored the immediate withdrawal of all American troops from Vietnam, but just 29 percent of the class of ’35 did. Similarly, 77 percent of the class of ’69 consid-ered non-violent protests on col-lege campuses a “healthy sign for America,” but just 42 percent of the 1935 respondents agreed. The magazine’s cover story focused on a group of students who traveled to Belize to study tropical biology and coral reefs. Another story recounted the histo-ry of St. Stanislaus, the then-recently closed Jesuit seminary located in Florissant, Mo. Quotable UTAS: “Never under-estimate the power of an idea in the mind of a Jesuit. … They’re a remarkably tenacious breed.” — Associate editor Jane Priwer, in her story about the Belize research group. Sign of the times: It was reported that the student activities commit-tee’s sponsorship of a lecture by William Kunstler, lawyer for the “Chicago Seven,” caused quite a bit of controversy. Some local alumni attempted to pressure the University to cancel the speech, but the administration allowed it, confi-dent that “the student at Saint Louis University has a level of intelligence and good judgment such that he is able to evaluate, at their proper worth, the words and actions of the speakers whom he hears.” CLASS ACT: Fitzgerald Hall is open for classes for the first time. Following the move of the building’s former occupants (SLU’s human resources and business offices) to Salus Center, Fitzgerald Hall underwent summer renova-tion and opened its doors to students in August. Soon the political science and sociology departments will have offices there, too. COMPACT EXHIBIT: Now through Dec. 31 Samuel Cupples House presents “Oh, Vanity,” an exhibition of antique glass vanity objects from the 19th and early 20th centuries. The display includes antique functional objects in silver, ceramic and glass, such as perfume bottles, barber bottles, shaving mugs, powder boxes and dresser sets. Cupples House is open from 11 a.m. to 4 p.m. Tuesday through Saturday. Chair endowed in neurosurgery Neurosurgeon Dr. Richard Donald Bucholz is the first holder of the K.R. Smith Endowed Chair in Neurosurgery at Saint Louis University School of Medicine. Greek groups boast high GPAs The University’s fraternity and sorority scholarship repo

    Universitas: the magazine of Saint Louis University

    No full text
    Spring 2007 issue of Universitas: the magazine of Saint Louis UniversityRemembering Father Mac PAGE 8 DR. ROB E RT BELSHE DR. MAR K BULLER PA UL C Z YS Z DR. G REG EVANS DR. DEE ANNA GL ASER DR. JOEL GOL DS TEIN DR. JERRY KAT Z DR. JOHN MORL E Y DR. K EN WA RREN DR. TER RI L . WEAVER VACCINE DEVELOPMENT VIRAL-BORNE DISEASES AIR CRASH INVESTIGATION BIOTERRORISM COSMETIC DERMATOLOGY VICE PRESIDENCY ENTREPRENEURSHIP GERIATRIC MEDICINE U.S. POLITICS POSTTRAUMATIC STRESS DISORDER Hearing Voices PAGE 16 Trophy Life PAGE 20 Volume 33, Issue 2 E d i t o r Laura Geiser (A&S ’90, Grad ’92) C o n t r i b u t o r s Clayton Berry Marie Dilg (SW ’94) Jeff Fowler Jeanette Grider Joe Muehlenkamp (A&S, Cook ’89, Grad ’98) Rachel Otto Andrea Roewe Nick Sargent Nancy Solomon “ O n C a m p u s ” n e w s s t o r i e s University Communications Medical Center Media Relations Billiken Media Relations De s i g n Art Direction: Matthew Krob Universitas is published by Saint Louis University. Opin-ions expressed in Universitas are those of the individual authors and not necessarily those of the University ad-ministration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for pub-lication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 221 N. Grand, St. Louis, Mo. 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, Universitas. Postmaster: Send address changes to Universitas, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html Universitas is printed by Universal Printing Co. and mailed by Specialty Mailing. Worldwide circulation: 118,600 © 2007, Saint Louis University All rights reserved. Each spring I look forward to our com-mencement ceremony. There is just something about the sound of the organ filling Scottrade Center and the sight of hun-dreds of graduates having their pictures taken in their caps and gowns smiling ear-to-ear flanked by a parent on each side with even bigger smiles on their faces. I love the banners, the academic attire and the ritual of it all. It is an exciting time for professors, students and parents alike, and the thrill culminates for me when I get to roar at the end of the ceremony: “I declare you sons and daughters of Saint Louis University forever!” Many students find it difficult to see past my role as priest and president, but at heart, I am also an educator. I spent 12 years as a mem-ber of the faculty at Loyola University Chicago teaching and six years as a dean at Loyola be-fore I became president of SLU. I value my time as a professor because what I learned from my students in the classroom has influenced the educa-tion- focused decisions I have made as president here. So, it is a joy for me to see so many students excited about what they have achieved during their time at SLU and to witness their enthusiasm for the future. Every year, I wonder how the gradu-ates in the audience will go on to achieve great things and how the University will play a role in those successes. With nearly 108,000 SLU alumni living around the world, there are many stories of SLU sons and daughters making the University proud. But in February, I was blessed to spend time with one of those sons. He has not only gone on to achieve great success, he saw fit to share it with SLU. I am sure some of you will find familiar the name that adorns the Chaifetz Arena (read more on page 2), our long-awaited, on-campus arena, because its namesake may have been a former classmate. Dr. Richard A. Chaifetz, who made a 12 million naming rights gift to the arena project, graduated from Saint Louis University in 1975 with a bachelor’s degree in psychology. During the past 30 years, Chaifetz founded Chicago-based ComPsych Corp. and oversaw its growth into the world’s largest provider of employee-assistance programs. It’s truly a blessing that Rich is sharing the success he achieved after graduating from SLU. But as an educator, I was more touched to hear Rich tell the story that inspired him to give back to his alma mater. During a press conference announcing his do-nation, Rich told the media in attendance about the day he visited the office of former University President Paul Reinert, S.J. As Rich told those in attendance, he was faced with the possibility of having to leave SLU because he could not pay his tuition. When Rich reached the president’s office, he was obviously nervous. But Father Reinert took the time to meet with him and listened to his story. Rich punctuated his plea to stay at SLU by promising that if Father Reinert allowed him to remain in school, he would not only pay SLU the tuition he owed but give back even more when he established him-self. Clearly, he’s made good on that promise. Rich truly understands the benefits he received by attending Saint Louis University, not only be-cause of the investment Father Reinert made in him, but the kindness that all those who support the University showed him. Donations, whether small or large, make it possible for future gen-erations to share in the educational experience you received at Saint Louis University. As we push forward to have SLU recognized as the finest Catholic university in the nation, we will continue to need the assistance and leader-ship of sons and daughters like Rich — and like you. By making the University even better, you not only give current students the opportunities you received, you strengthen the value of your degree as SLU’s stature and reputation improve across the country. No matter how long ago it was that you took those special pictures with your parents or felt the excitement of graduation rush over you as “Pomp and Circumstance” began to play, I hope you will always remember you are sons and daughters of Saint Louis University, forever. — Lawrence Biondi, S.J. P r e s i den t ’ s Me s s age U N I V E R S I T A S w w w . s l u . e d u U N I V E R S I T A S S P R I N G 2 0 0 7 F EAT U RES DE PARTMENTS 2 On Campus Arena named for Chaifetz Service hours grow Med dean to retire New endowed chairs Rec Center expands 6 Billiken News Three fall NCAA Tourney appearances New Hall of Fame inductees 7 Campaign Update A conversation with Tom Keefe, development vice president 24 Class Notes Catch up with classmates 28 In Memoriam Remembering those members of the SLU community who recently died 30 Alumni Events Find SLU alumni activities wherever you live 32 Perspective An alumnus shares the courage and inspiration of his college roommate 33 The Last Word Letters to the editor 8 16 Remembering Father Mac SLU’s champion of Cupples House and the arts, Maurice McNamee, S.J., died in January. By Clayton Berry and Nick Sargent Meet the Experts Insights and experiences from 10 faculty members who frequently appear in the media. 10 Photos by Jim Visser 20 Hearing VOICES An innovative program helps members of the SLU community find their calling. By Marie Dilg Trophy Life A Q&A with alumnus Mark Lamping, president of the St. Louis Cardinals. By Laura Geiser A springtime workout at the expanded Simon Recreation Center. Photo by Jim Visser U N I V E R S I T A S w w w . s l u . e d u U N I V E R S I T A S S P R I N G 2 0 0 7 6,000 Lineal feet of underground piping used in the construction 34,000 Square feet of brick being used in the project — enough to cover a regulation basketball court 7.25 times » Saint Louis University announced Feb. 28 that its new 10,600- seat multipurpose arena will be named in honor of University alumnus Dr. Richard A. Chaifetz (SHAY-fetz), who made a 12 million naming rights gift to the project. Chaifetz Arena will open in March 2008. It will be home to Billiken men’s and women’s basketball and will host other events. Chaifetz (A&S ’75) is a licensed neuropsychologist and is founder, chairman and CEO of Chicago-based ComPsych Corp., the world’s largest provider of employee-assistance programs (EAP). ComPsych is also the leading provider of fully integrated EAP, behavioral health, work-life, wellness, crisis intervention services and outsourced human resources solutions under the GuidanceResources brand. ComPsych provides services to more than 25 million individuals and 10,000 or-ganizations throughout the United States and 92 countries. Chaifetz is one of the world’s most frequently quoted experts on behavioral health, workplace issues as well as employer and employee trends. “It is an honor for Saint Louis University to have Dr. Richard Chaifetz’s name on our arena, which will mean so much to the Uni-versity and the entire St. Louis community,” said University President Lawrence Biondi, S.J. “Not only is Dr. Chaifetz respected around the world for the success of ComPsych Corp., but we take special pride because he is an extremely successful alumnus who cares deeply about his alma mater and future generations of SLU students.” “I am proud to have the University name this arena in my honor,” Chaifetz said. “My education at Saint Louis University has had a tre-mendous impact upon my life, both personally and in business. As an avid sports fan, I have fond memories of the many sporting events I attended while an undergraduate at SLU. Having the arena in my name is especially meaningful.” Chaifetz is a native of New York, and in 1971 he turned down an appointment to the U.S. Military Academy at West Point to attend SLU on the advice of his high school dean and mentor. He credits for-mer University President Paul Reinert, S.J., with helping him remain at SLU when financial issues threatened his ability to stay in school. “Father Reinert told me he believed in me and allowed me to stay at SLU at a time in my life when I didn’t have the financial resources to pay for my tuition,” Chaifetz said. “I promised him not only would I pay my tuition, but that I would pay back the University in an even bigger way in the future. Now, this is an opportunity for me to give back to the University for all the support and guidance I received as an undergraduate here. It is my hope that Chaifetz Arena will en-hance the on-campus experience for every future Saint Louis Univer-sity student, as well as the city of St. Louis.” Chaifetz has been named to the Who’s Who list of Crain’s Chi-cago Business for three consecutive years — 2004, 2005 and 2006. He serves on the board of directors of several corporations, as well as nonprofit organizations. Chaifetz received his Psy.D. from the Il-linois School of Professional Psychology. He is married and has two children. — Jeff Fowler At the construction site of the new Chaifetz Arena SLU lauded in recent rankings Two publications, St. Louis Maga-zine and the St. Louis Business Journal, have recognized Saint Louis University as one of the area’s best places to work. St. Louis Magazine named the region’s “45 companies that know how to keep their employees happy.” SLU was highlighted for its award-winning retirement plan. In addition, for the second straight year, the St. Louis Regional Chamber and Growth Association named SLU to its list of “Greater St. Louis Top 50 Businesses Shaping Our Future.” The 50 companies recognized in 2006 were selected for their contributions to the St. Louis region and future impact on the business community. more than 300 Philosophy professors worldwide name saint louis University programs among the best Top philosophers from around the world gave high marks to philosophy pro-grams at Saint Louis University. The Philosophical Gourmet Report ranked SLU’s medieval philosophy program the best in the United States and rated the philosophy of religion program behind only those at Notre Dame and Oxford universities. SLU also earned a special mention in epistemology, the philosophy of knowledge. More than 300 philosophy professors worldwide completed online surveys about philosophy departments in the United States, Canada, the United Kingdom, Australia and New Zealand. SLU welcomes noted speakers The former prime minister of Israel, Ehud Barak, visited Saint Louis University earlier this year and dis-cussed “Blueprint for Global Relations: A Macro Analysis of How National Politics, International Events, Terror and the Econ-omy All Influence National and Interna-tional Relations.” Prime minister of Israel from 1999 to 2001, Barak led the country out of prolonged recession and into an eco-nomic boom. In February, famed filmmaker Spike Lee was the keynote speak-er for SLU’s celebra-tion of Black History Month. He is known for such films as Do the Right Thing and When the Levees Broke, a documentary focus-ing on the plight of Americans stranded in New Orleans after Hurricane Katrina. Lee delivered a presentation titled “The Media’s Affect on Black America.” The spring 1982 edition of Universitas featured the cover story “Portrait of the Class Clown” describing a student’s effort to become a professional clown. He said running away to the circus is not as easy as it sounds. Don Ganz (A&S ’78, Grad Cook ’83) shared his experience at Barnum & Bailey Clown College and how that opportunity made him more marketable. After his three-month adventure at clown college, Ganz returned to SLU to complete his MBA. The magazine also included an article, remembering Joseph “Buck” Davis, S.J. The story reflected his many contributions to the University in his years of service. The founder of what is now the John Cook School of Business, Davis used his self-taught business skills to recruit nearly the entire staff for the school. Businessman Martin Shaughnessy, a close friend of Davis’, donated 750,000 for construction of a home for the school, which was named Davis-Shaughnessy Hall for their efforts. Also, in this issue, University President Thomas Fitzgerald, S.J., discussed changes in national legislation for financial aid. Fitzgerald focused on SLU’s dedication and commitment to its students. He said the administration was working on ways for students to afford a SLU education, in light of the financial aid cuts proposed by President Ronald Reagan. Lee Sign of the Times Sister Mary Terese Donze (A&S ’44), a resident of DeMattias Hall, shared one of her many inventions — a gadget that rewound adding machine paper so it could be used four times instead of just once. – from the story titled “Nun Has 2nd Career as Inventor/ Author” Quotable UTAS “Thomas Aquinas long ago pointed out that learning takes place only if the learner does something. One cannot pour knowledge into the head or heart of a student as one pours wine into a glass.” — Dr. Francis L. Gross Jr. (A&S ’55, Grad ’56, ’64), an author speaking about his book Passages in Teaching: Predictable Crises in the Teaching of Adolescents and Young Adults. Gross taught in the theology department from 1966 to 1969. Arena named for alumnus Richard Chaifetz Make a gift and follow the construction of Chaifetz Arena at arena.slu.edu. Photos by Kevin Lowder above LEFT: Chaifetz (far right) and his family look over a 1975 SLU yearbook with Mary Bruemmer (second from left), former dean of women and University volunteer. Center: The Chaifetz family (from left), Jessica, Ross, Richard and Jill with a rendering of Chaifetz Arena. right: Biondi (left) presents Chaifetz with a Billiken basketball jersey. Biondi (left) and Chaifetz at the news conference announcing the new name. U N I V E R S I T A S w w w . s l u . e d u U N I V E R S I T A S S P R I N G 2 0 0 7 Photo by Jim Visser News Briefs Drs. Paul J. Shore, Todd Swanstrom and Stephen Paul Wernet received Fulbright Scholar grants this school year. Shore, a professor of educa-tional studies, is at the Collegium Budapest in Hungary. Wernet, a pro-fessor of social work, is at Ostrava University in the Czech Republic. And Swanstrom, a professor of public policy studies, is at the University of Amsterdam in the Netherlands. Dr. Charlotte Royeen, dean of the Doisy College of Health Sciences, won the National Jesuit Book Award for 2006. Royeen is co-editor of Educat-ing for Moral Action: A Sourcebook for Health and Rehabilitation Ethics. Darius U. Dunn is the general manager of the new Chaifetz Arena. Dunn previously served as associate director of the Stephen O’Connell Center at the University of Florida. Dr. Brian D. Till, chairman of the mar-keting department at the John Cook School of Business, was appointed to the Clarence and Helen Steber En-dowed Professorship in Marketing. The endowed professorship was created in 1971 to recognize a scholar in the field of marketing for teaching, scholarly work and work with the business com-munity. At the construction site of the new Chaifetz Arena 430,000 Hours of work that will be spent on the 18-month project 75,000 Cubic yards of dirt that will be moved during construction — about 375,000 full wheelbarrow loads 191 Drilled piers in the foundation, each approximately 30 feet tall campus enthusiastically embraces RecREATION Center expansion The University recently completed a 40,000-square-foot expansion of the Simon Rec-reation Center, paid for by students who voted to assess themselves a fee to fund the project. The new space includes more than 150 new pieces of fitness equipment, a juice bar and lounge, additional locker rooms, several multipurpose rooms, wellness suite, traversing wall and gaming area. Students so enthusiastically embraced the expansion that less than a month after it opened, the Rec Center expanded its hours to meet demand. Additional improvements are planned for this school year. The second phase of the project includes renovations to the main level and the second floor. The lobby, locker rooms, elevated track and special event rooms will be updated. An elevator also will be installed. DEAN OF THE SCHOOL OF MEDICINE ANNOUNCES HER RETIREMENT Dr. Patricia L. Monteleone (Med ’61, Pub Hlth ’91, Grad Cook ’91) one of the first women appointed to lead a U.S. medical school when she was named the 11th dean of Saint Louis Uni-versity School of Medicine in 1994, announced her intention to retire in March. With 13 years of service, she is the longest continuously serving woman dean in the history of U.S. medical schools. Monteleone, a pediatrician with an expertise in medical genetics, has presided over the school during a time of rapid change in American medicine. She has overseen a restructuring of the school’s medical cur-riculum; an expansion in the amount of research funding at the school from both governmental and private industry sources; and the creation of the University Medical Group (SLUCare), the clinical practice of the faculty at SLU School of Medicine. Monteleone will continue to serve as dean until a new dean is identified. Endowed chairs honor donors, slu scholars Thanks to generous donations, SLU added two endowed chairs during the last year. The James B. and Joan C. Peter Endowed Chair in Biochemistry and Molecular Biol-ogy was made possible by a donation of 2 million from Dr. James and Joan Peter. The Hubert Mäder Endowed Chair in Health Care Ethics was made possible through a $1.5 million donation from the Geschwister Mader Foundation in Zurich, Switzerland. Dr. James B. Peter (Med ’58) has had a distinguished career in academic medicine and business. He is founder and former chief executive officer of Specialty Labo-ratories, a leading hospital-focused clinical reference laboratory. He and his wife, Joan, generously supported research and educa-tion at SLU for many years. Dr. William S. Sly (Med ’57) is the inaugural chair holder. Huber Mäder, a surgeon and philanthro-pist, created his foundation to demonstrate his lifelong passion for the ethical practice of medicine. Dr. James M. DuBois is the inaugural chair holder. Annual service hours soar to nearly 780,000, survey says Members of the Saint Louis University community certainly know how to give back. In 2006, SLU students, faculty and staff contributed 779,776 hours of commu-nity service and outreach, according to the report, “Beyond the Classroom.” That’s more than in 2005 (753,806) and up significantly from five years ago, when the reported number of service hours was approximately 490,000. SLU’s academic courses and programs provide great opportunities for service. According to the new report, SLU students spent more than 80,000 hours helping the community through class and program-sponsored activities. virtual tour of italian church possible via new technology Using technology typically associ-ated with video games, two SLU theologians created an interac-tive, 3-D tour of one of Europe’s most im-portant churches. Theology professors Drs. Jay Ham-mond (A&S ’93, Grad ’94, ’98) and James Ginther spent more than a year building the virtual version of Italy’s landmark Ba-silica of Saint Francis of Assisi. Their 3-D model allows virtual tour-goers to walk nearly everywhere in the upper basil-ica and fly close to the church’s famed paint-ings and stained-glass windows. Most virtual tours of historic buildings rely on 360-degree panoramas and offer limited interactivity. Other virtual tour projects have been equally advanced, but the SLU professors’ tour is one of the first able to run on a PC. Ignatian retiree group looking for new volunteers The Ignatian Volunteer Corps is searching for retirees to help with the good work its chapters are doing across the county. The IVC is an organization that combines service to the poor with a unique process of spiritual reflection. Established in 1995 by Jesuit priests Jim Conroy, S.J., and Charlie Costello, S.J., the program is for retired women and men, age 50 and older. To learn more about the IVC or to sign u

    Universitas: the magazine of Saint Louis University

    No full text
    Winter 2020 issue of Universitas: the magazine of Saint Louis University.10 facts about SLU-Madrid Page 14 RECORD-SETTING CLASS Page 20 NEW CAREER CENTER Page 24 ST. LOUIS JESUITS’ CONCERT Page 26 FACULTY EXPERT ON VICE PRESIDENCY Page 30 WINTER 2020 | 1 VOLUME 46, ISSUE 1 EDITOR Laura Geiser (A&S ’90, Grad ’92) ASSOCIATE EDITOR Amy Garland (A&S ’97) ART DIRECTOR Matt Krob CONTRIBUTORS Jessica Ciccone Marie Dilg (Grad SW ’94) ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER SLU-Madrid students in Plaza Mayor in the heart of Madrid Photo by Fernando Béjar Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 1 N. Grand Blvd., St. Louis, MO 63103. We accept email at [email protected]. Postmaster: Send address changes to Universitas, Saint Louis University, 1 N. Grand Blvd., St. Louis, MO 63103. Website: slu.edu/universitas Universitas is printed by Breese Printing and Publishing Worldwide circulation: 123,557 © 2020, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. New and returning students gather at the first 9 p.m. Mass of the school year in St. Francis Xavier College Church. PHOTO BY STEVE DOLAN F E ATU R E S D E PARTME NTS 14 ¿Sabías? Ten facts about SLU-Madrid that might surprise you. — By Laura Geiser 20 Top Class The freshman class is the largest in SLU’s history. — By Marie Dilg 24 Beyond Career Fairs SLU’s Career Services focuses on preparing students for life after SLU. — By Marie Dilg 26 Coming Home The St. Louis Jesuits music group says farewell with a sold-out concert. — By Amy Garland 30 Vice Presidential VIP Law professor Joel K. Goldstein is the nation’s top VP expert. — By Jessica Ciccone 2 On Campus Women’s soccer A-10 championship /// Record fundraising year /// Nursing school’s new name /// Midtown development update /// Rankings /// Opus Prize 34 Class Notes 35 Alumni Spotlight Angela Lewis (A&S ’04, Grad A&S ’07) 36 How I Got Here Jim Dean (CSB ’88) 40 Letters to the Editor 41 In Memoriam 44 By the Numbers 45 The Last Look That is certainly what our campus in Spain aims to achieve — and accom-plishes with great success. From signage to statutes, SLU-Madrid succeeds at carrying out our branding. But much more than that, it lives our mission. This campus shares our vision for building a better world with more Jesuit-educated graduates. To do so on the global stage is a testament to the power of a SLU education. The stories I hear from our students, both when I visit SLU-Madrid and those who come back to St. Louis after spending time studying abroad, never cease to amaze me. Their stories and experi-ences remind me why I was called to higher education. As you will see in this issue, our students absorb culture through their time with señoras, or host families, who help broaden their perspective of Spanish culture. (Read more on page 16.) Learning does not stop when our students leave class — and in this increas-ingly connected world, it is more important than ever to lead them to become informed global citizens. The excitement we feel at SLU crosses international waters, and I’m thrilled this issue brings you a flavor of the pride we feel for our Madrid and St. Louis campuses. From regional development to record-breaking enrollment and fundraising, we certainly look forward to sharing our good news. The start of our third century and SLU-Madrid’s 52nd year brought a record-setting year for us at Saint Louis University. Our freshman class in St. Louis broke all enrollment records with 1,900 students, surpassing our previous largest class by 200 students. (Turn to page 22 to learn more.) SLU-Madrid continues to draw hundreds of students from dozens of countries who learn and grow together. And thanks to our generous donors, we once again raised a record amount in gifts for scholarships, academics, research and other ini-tiatives. We are well on our way to our 500milliongoalinourcampaign,knownasAcceleratingExcellence:TheCampaignforSaintLouisUniversity.(Seethestoryonpage10.)Whilewecertainlycelebratetheseachievements,wewillneverrestonthem.Thatsthejoyandthechallengeofacademiaalwaysplanningandadaptingfortheeverchangingworldinwhichweoperate.Themanywaysinwhichwemeetthoseneedsisbroad.Forexample,regionaldevelopmentandthephysicalchangesacrosscampus.AswelooktoourUniversitysfuture,wecontinuetofocusonopportunitiesthatwillstrengthentheUniversityforgenerationstocome.YouwillreadmoreinthisissueaboutafewexamplesoftheburgeoningdevelopmentintheMidtownSt.Louisarea.Theseincludeprojectsonandoffcampus.MomentumandexcitementcontinuetobuildforournewInterdisciplinaryScienceandEngineeringBuilding,andwearethrilledthatprogresscontinuesonthenew,500 million goal in our campaign, known as Accelerating Excellence: The Campaign for Saint Louis University. (See the story on page 10.) While we certainly celebrate these achievements, we will never rest on them. That’s the joy and the challenge of academia — always plan-ning and adapting for the ever-changing world in which we operate. The many ways in which we meet those needs is broad. For exam-ple, regional development and the physical changes across campus. As we look to our University’s future, we continue to focus on opportunities that will strengthen the University for generations to come. You will read more in this issue about a few examples of the bur-geoning development in the Midtown St. Louis area. These include projects on and off campus. Momentum and excitement continue to build for our new Interdisciplinary Science and Engineering Building, and we are thrilled that progress continues on the new, 550 million SSM Health Saint Louis University Hospital and Ambulatory Care Center. All will open this fall. SLU is also proud to be involved in developments that lead the resurgence taking place in the city’s central core, such as the redevel-opment of homes in the Gate District West neighborhood near the hospital, and the forthcoming City Foundry. (Read more on page 13.) As we share in the story about Gate District West, we are grate-ful to our St. Louis community neighbors for sharing our vision for and commitment to growing stronger together. In closing, I ask that you remember how these stories and the many initiatives behind them help fulfill our noble mission. I also ask that you share our exciting news with those you know who are young — or young at heart — who are seeking higher edu-cation. Tell them about SLU and your experience. Our world always benefits from more truth-seekers and servant leaders who are Jesuit educated. May God bless you and Saint Louis University. Dr. Fred P. Pestello President I cannot tell you what it’s like to step off of a plane after an eight-hour flight to Europe, only to walk onto a campus that feels just like home. Or perhaps I don’t have to tell many of you — those of you who have studied at or visited SLU-Madrid, or our international students in St. Louis. PRESIDENT’S MESSAGE PHOTO BY FERNANDO BÉJAR Pestello talks with students outside of San Ignacio Hall at SLU-Madrid. 2 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 3 ON CAMPUS Women’s Soccer Wins A-10 Again The Billikens women’s soccer team defeated George Washington 3-1 in the Atlantic 10 Conference Championship title game in November, securing its second straight A-10 Championship crown. Senior Courtney Reimer was named the most outstanding player of the championship. Senior Emma Farley, sophomore Hannah Friedrich, senior Alli Klug and graduate student Mary Niehaus joined her on the All-Championship team. Over the season, SLU extended its school-record unbeaten streak to 16 games. Already the winningest class in SLU women’s soccer history, the Billiken seniors registered their 64th victory. The team lost to Notre Dame in the first round of the NCAA Championship. Reimer Celebrating with the A-10 trophy Reimer (center) hugs Annabelle Copeland (left) and Farley. Farley The team celebrates at Robert R. Hermann Stadium on campus. PHOTOS BY BILL BARRETT 4 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 5 ON CAMPUS University Offers New Academic Programs, Begins Comprehensive Review Process Saint Louis University began offering many new academic programs in the fall, including: UNDERGRADUATE Bachelor of Arts in Leadership and Organizational Behavior Bachelor of Science in Health Care Ethics Minor in Dance GRADUATE Master of Science in Biostatistics and Health Analytics Doctorate in Education Policy and Equity GRADUATE CERTIFICATES American Studies Cybersecurity Strategic Intelligence Women’s and Gender Studies The University also started a formal review of its academic programs. In spring 2019, the provost established the Academic Portfolio Review Committee, tasked with analyzing and making recommendations to the provost about the size and academic scope of the University’s portfolio of offerings. This process will eventually become a regular assessment tool for all graduate and undergraduate programs. Led by faculty, the committee has representatives from the student body and administration. Dr. Mark Knuepfer, a professor in the School of Medicine, serves as the committee chair. Signature Beam: Students, faculty and staff signed their names and good wishes on the beam that would complete the topping-out of SLU's new Interdisciplinary Science and Engineering Building. Saint Louis University leaders, St. Louis Mayor Lyda Krewson, trustees, students, faculty and staff members marked the topping-out of the University’s new 50millionISEBuildingonDec.6.Thebuildingwillopenintimeforclassesthisfall.PHOTOBYAMELIAFLOODSLUNamesNursingSchooltoHonorTrudyBuschValentineInAugust,SaintLouisUniversityannouncedthatUniversitytrusteeTrudyBuschValentine(VSN80)madeagiftof50 million ISE Building on Dec. 6. The building will open in time for classes this fall. PHOTO BY AMELIA FLOOD SLU Names Nursing School to Honor Trudy Busch Valentine In August, Saint Louis University announced that University trustee Trudy Busch Valentine (VSN ’80) made a gift of 4 million in support of the School of Nursing and Accelerating Excellence: The Campaign for Saint Louis University. In recognition of Valentine’s history of philan-thropic support of SLU totaling nearly 7million,theUniversityrenameditsnursingschooltheTrudyBuschValentineSchoolofNursingandhostedadedicationduringHomecomingandFamilyWeekend2019.ValentinesgiftwasmadeinhonorofformerdeansDr.TeriMurray(VSN79,GradVSN93,GradEd97)andthelateDr.JoanHrubetz(VSN60,GradEd70,75)fortheirlegacyofleadershipofthenursingschool.Thegiftwillsupportfacultydevelopmentaswellascontinuedacademicexcellenceamongtheschoolsfacultyinteaching,research,scholarshipandleadership.ValentinehasbeenamemberoftheSaintLouisUniversityWomensCouncilsince1990.ShejoinedtheSchoolofNursingExecutiveAdvisoryboardin2000,assumingthechairpersonrolefrom2006to2015.ShewaselectedtoSLUsboardoftrusteesin2017.ValentineandherfamilyhavebeensupportersofSLUsnursingschoolforyears.Hermother,GertrudeBuholzerBusch,establishedanundergraduatescholarshipandtheJoanHrubetzEndowedChair.In2012,ValentineandherdaughterChristinaValentineCammon(VSN12)establishedtheTrudyandChristinaBuschValentineEndowedLectureSeries.Nursinghasmademerespectpeoplefromallwalksoflife,andithasopenedmyheart,mindandlifetothewellbeingofothers,Valentinesaid.ImsoproudtobepartofaprofessionthatcaressodeeplyaboutpeopleandcanmakesuchapositiveimpactonthelivesofothersaprofessionthatlivesSLUsJesuitmissiontoseekahigherpurposeforthegreatergood.IamsogratefultotheSaintLouisUniversitySchoolofNursingandveryhappytohonorDeanTeriMurray,adearfriendandmentor,forhermanyyearsofserviceandmagnificentleadership.Anactiveconservationistandphilanthropist,ValentinealsohasworkedasavolunteernurseattheSalvationArmyResidenceforChildren,MercyHospitalandtheVisitingNurseAssociationHospiceprogram.ValentinePHOTOBYSTEVEDOLANNOTEWORTHYGRANTSGERIATRICCAREINMISSOURI7 million, the University renamed its nursing school the Trudy Busch Valentine School of Nursing and hosted a dedication during Homecoming and Family Weekend 2019. Valentine’s gift was made in honor of former deans Dr. Teri Murray (VSN ’79, Grad VSN ’93, Grad Ed ’97) and the late Dr. Joan Hrubetz (VSN ’60, Grad Ed ’70, ’75) for their legacy of leadership of the nursing school. The gift will support faculty development as well as continued academic excellence among the school’s faculty in teaching, research, scholarship and leadership. Valentine has been a member of the Saint Louis University Women’s Council since 1990. She joined the School of Nursing Executive Advisory board in 2000, assuming the chairperson role from 2006 to 2015. She was elected to SLU’s board of trustees in 2017. Valentine and her family have been supporters of SLU’s nursing school for years. Her mother, Gertrude Buholzer Busch, established an undergraduate schol-arship and the Joan Hrubetz Endowed Chair. In 2012, Valentine and her daughter Christina Valentine Cammon (VSN ’12) established the Trudy and Christina Busch Valentine Endowed Lecture Series. “Nursing has made me respect people from all walks of life, and it has opened my heart, mind and life to the well-being of others,” Valentine said. “I’m so proud to be part of a profession that cares so deeply about people and can make such a positive impact on the lives of others — a profession that lives SLU’s Jesuit mission to seek a higher purpose for the greater good. I am so grateful to the Saint Louis University School of Nursing and very happy to honor Dean Teri Murray, a dear friend and mentor, for her many years of service and magnificent leadership.” An active conservationist and philanthropist, Valentine also has worked as a volunteer nurse at the Salvation Army Residence for Children, Mercy Hospital and the Visiting Nurse Association Hospice program. Valentine PHOTO BY STEVE DOLAN NOTEWORTHY GRANTS GERIATRIC CARE IN MISSOURI 3.75 million Supported by a five-year grant from the U.S. Department of Health and Human Services, Dr. John Morley, professor of internal medicine, and Dr. Marla Berg-Weger, executive director of SLU’s Geriatric Education Center and professor of social work, will partner with multiple educational, patient care and service organizations in educating, studying and caring for older adults. COMMUNICATION WITH PARENTS OF SICK CHILDREN 3.26millionDr.VernaHendricksFerguson,theIreneRiddleEndowedProfessorofNursingatSLU,isaprincipalinvestigatorforthisfirstofitskindstudy.Thegoalofthefiveyearstudyistoseeifearlypalliativeandendoflifecarediscussionsatthetimeofachildscancerdiagnosiswillimprovethequalityoflifeforparentsandtheirchildren.NONADDICTIVEPAINKILLEROPTIONS3.26 million Dr. Verna Hendricks-Ferguson, the Irene Riddle Endowed Professor of Nursing at SLU, is a principal investigator for this first-of-its-kind study. The goal of the five-year study is to see if early palliative and end-of-life care discussions at the time of a child’s cancer diagnosis will improve the quality of life for parents and their children. NON-ADDICTIVE PAINKILLER OPTIONS 2.1 million Addressing the need for better pain medications, Dr. Daniela Salvemini and her colleagues at the Henry and Amelia Nasrallah Center for Neuroscience at SLU will investigate a promising pain-signaling pathway in the hopes of opening up a new avenue for pain medication research. CELLULAR CHANGES WITH HEART DISEASE, DIABETES 1.8 million Chemistry professor Dr. Jim Edwards (A&S ’99, Grad A&S ’01) received this National Institutes of Health grant to understand cellular changes that could lead to better therapies for diabetes and heart disease. Dr. Chris Arnatt, assistant professor of chemistry at SLU, is also a principal investigator. OBESITY, CANCER IMMUNOTHERAPY 1.7 million Dr. Ryan Teague, associate professor of molecular microbiology and immunology, will study how obesity influences outcomes for cancer patients being treated with immunotherapy. ANTI-DIARRHEAL DRUG 1.65millionAssociateprofessorofchemistryDr.MarvinMeyerswillusethisNationalInstitutesofHealthgranttofocusonintelligentdrugdesignfindingnewdrugsforinfectiousdiseasesthatkillmillionsandaredevastatingforthepoor.Dr.DaveGriggs,associateprofessorofmolecularmicrobiologyandimmunology,isanotherprincipalinvestigator.SLUStartupRaises1.65 million Associate professor of chemistry Dr. Marvin Meyers will use this National Institutes of Health grant to focus on intelligent drug design — finding new drugs for infectious diseases that kill millions and are devastating for the poor. Dr. Dave Griggs, associate professor of molecular microbiology and immunology, is another principal investigator. SLU Startup Raises 30 Million in Bid to Better Manage Pain In one of the biggest investments in research com-mercialization in Saint Louis University’s history, BioIntervene, a biopharmaceutical company founded in 2014 by SLU pharmacologist Dr. Daniela Salvemini has raised 30millioninseriesAfundingfromMPMCapital.TheinvestmentwillpropelSalveminisdiscoveriesforwardandsetthestagetobeginPhaseIclinicaltrialsforanewnonaddictivepainkillerlaterthisyear.Salvemini,whoisprofessorofpharmacologyandphysiologyanddirectoroftheHenryandAmeliaNasrallahCenterforNeuroscienceatSLU,pioneeredresearchonatreatmentforneuropathicpainthatcouldprovidethefirstalternativetoineffectivesteroidsandaddictiveopioids,amarketprojectedtoreach30 million in series A funding from MPM Capital. The investment will propel Salvemini’s discov-eries forward and set the stage to begin Phase I clinical trials for a new non-addictive painkiller later this year. Salvemini, who is professor of pharmacology and phys-iology and director of the Henry and Amelia Nasrallah Center for Neuroscience at SLU, pioneered research on a treatment for neuropathic pain that could provide the first alternative to ineffective steroids and addictive opi-oids, a market projected to reach 8.3 billion by 2024. Neuropathic pain affects between 15 and 20 million people in the United States. Exceedingly difficult to treat, this type of pain can occur after injuries to the nervous system due to trauma, disease or exposure to neurotox-ins, including after chemotherapy. There is a need for new medications that do not cause side effects and addic-tion the way narcotic pain killers do. “Having the opportunity to translate one’s discover-ies from the bench to the bedside is a dream come true,” Salvemini said. “I am hopeful that our efforts will lead to the alleviation of suffering while helping end the opi-oid crisis.” Salvemini discovered that alterations in signaling within the body contribute to the development of chronic pain states and that compounds that target a key recep-tor can “turn off” pain signals, providing relief from chronic pain of various types. This discovery, she noted, provided the starting point of her collaboration with Dr. Kenneth Jacobson, chief of the molecular recognition section, in the laboratory of bioorganic chemistry at the National Institutes of Health. Salvemini SUBMITTED PHOTO 6 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 7 ON CAMPUS SLU Research Institute Grants Second Round of Funding The Saint Louis University Research Institute awarded its second round of funding last summer: More than 740,000wasgivento13facultymembersthroughtheResearchGrowthFund.Morethan70proposalshadbeensubmitted.LaunchedinSeptember2018throughagiftfromDr.JeanneandRexSinquefield(CSB67)thelargestgiftinUniversityhistorytheSLUResearchInstitutefurthersSLUsgoalofbecomingtheworldsleadingJesuitresearchuniversity.ThefirstroundofgrantswasannouncedinJanuary2019,withatotalof740,000 was given to 13 faculty members through the Research Growth Fund. More than 70 proposals had been submitted. Launched in September 2018 through a gift from Dr. Jeanne and Rex Sinquefield (CSB ’67) — the largest gift in University history — the SLU Research Institute furthers SLU’s goal of becoming the world’s leading Jesuit research university. The first round of grants was announced in January 2019, with a total of 1.8 million going to 15 faculty members. Among the 13 faculty who received grants in this second round are: Miriam Cherry, professor and co-director of the William C. Wefel Center for Employment Law, who will study methods of online justice such as amateur sleuths gathering online to collect clues in cold cases, workers sharing information online about abusive labor practices and people using the Internet to mount harassment campaigns. Dr. Terra Edwards, assistant professor of anthropology, who will finish a book manuscript, Going Tactile: Life at the Limits of Language. Her research focuses on the protactile movement, which advances the claim that hearing and vision are not necessary for things like greeting people or joining or leaving a conversation. Dr. David Ford (A&S ’80), professor of biochemistry and molecular biology and director of the Center for Cardiovascular Research, who will use new technology to investigate endothelial and epithelial barrier dysfunction. This technology will be used in the planning for a SLU Sepsis Center and the SLU Institute for Drug and Biotherapeutic Innovation. Jesuits Reckon with the Legacy of Slavery In late August, Jesuits of the USA Central and Southern (UCS) Province began contacting individuals believed to be descen-dants of people held in slavery by 19th century Jesuits, including at Saint Louis University. This is the latest work of the Slavery, History, Memory and Reconciliation Project, which started in 2016 as a joint initiative of the UCS Province and the University. The goal is to find a path to reconciliation by illuminating the lives of the people who were enslaved and connecting with their descendants. Historians have long known that when Jesuits established mis-sions in St. Louis, they relied on the labor of enslaved people to help those missions survive. To reveal the stories of courage and resil-ience among those who were enslaved and to trace their families forward, researchers have combed through thousands of docu-ments, including financial ledgers, Church records and personal journals. Dr. Jonathan Smith, SLU’s vice president for diversity and com-munity engagement, is leading the project for the University. To undertake a conversation about SLU’s next steps, Smith plans to assemble a working group that will include students, faculty, staff, alumni, trustees and descendants. To learn more about the project and to read the stories about the people who were enslaved, visit shmr.jesuits.org. SLU Launches Geospatial Institute Anew Geospatial Institute at Saint Louis University will support research, training and innovation in the rapidly growing fields of geospatial science and technology. Also known as GeoSLU, the institute brings together faculty and students from various disciplines to use geospatial research tools to solve challenges and to enhance graduate and undergraduate education. The institute’s primary areas of research will include artificial intelligence, machine learning and informatics. In launching the Geospatial Institute, SLU seeks to strengthen collaborations with other universities, including the University of Missouri System schools, Washington University in St. Louis and Harris-Stowe State University, as well as innovation partners in the region, including Cortex and T-Rex. GeoSLU also builds upon SLU’s existing relationship with the National Geospatial-Intelligence Agency (NGA). In January 2019, the University signed a partnership agreement with the NGA, and the organizations partnered on the GeoResolution conference last April. Dr. Vasit Sagan, associate professor of earth and atmospheric sciences, is the institute’s faculty director. Robert Cardillo, former director of the NGA, advises the institute as part of his work as a distinguished geospatial fellow at SLU. For more information, visit slu.edu/geoslu. Nancy McNeir Ring Award Presented for Excellence in Teaching Dr. Katie Kelting, assistant professor of mar-keting in the Richard A. Chaifetz School of Business, was selected as the recipient of SLU’s 2019 Nancy McNeir Ring Award for excellence in teach-ing. Lauded by students for her emphasis on teaching them the value of ethics in the business world, Kelting joined the SLU faculty in July 2016 and is director of the business school’s Behavioral Research Lab. On a national level, she is a Women in the Marketing Academy Fellow, among her many fellowships. She addressed graduates during December’s midyear commencement at Chaifetz Arena. Kelting PHOTO BY STEVE LONG PHOTO BY STEVE DOLAN Special Guest Star: The Stanley Cup makes a stop on campus during Homecoming and Family Weekend 2019, giving fans of the 2019 NHL champion St. Louis Blues hockey team the opportunity to make lasting memories. SLU, Urban League Honor MLK’s Legacy At their annual memorial tribute honoring civil rights leader the Rev. Dr. Martin Luther King Jr. on Jan. 16, Saint Louis University and the Urban League of Metropolitan St. Louis honored those carrying forward King’s legacy of activism and advocacy for racial equity and justice across the St. Louis region. The keynote speaker, noted journalist and author Roland Martin, told the crowd in SLU’s Busch Student Center that “leaders step up when it’s time to lead.” He chal-lenged those attending the tribute to recall King not as a mascot, but for his radical commitment to social justice a
    corecore