1,643 research outputs found

    Universitas: the magazine of Saint Louis University

    No full text
    Summer 2006 issue of Universitas: the magazine of Saint Louis UniversityS i n g i n g g roup wo r k s i n h a r mo n y pg. 9 B i o l o gy fac ult y m a k e t he ir m a r k pg. 12 A l um n i c h a n g e c hil d r e n’s l i v e s pg. 18 B a s e b a l l t e a m p l ay s i n n c a a t our n a me n t pg. 6 F E AT U R E S DE PA R TMEN T S E d i t o r Laura Geiser (A&S ’90, Grad ’92) C o n t r i b u t o r s Allison Babka Burney Marie Dilg (SW ’94) Shannon McGuire (Student Assistant) Rachel Otto “ O n C a m p u s ” n e w s s t o r i e s University Communications Medical Center Media Relations Billiken Media Relations D e s i g n Art Direction: Matthew Krob Universitas is published by Saint Louis University. Opin-ions expressed in Universitas are those of the individual authors and not necessarily those of the University admin-istration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 221 N. Grand, St. Louis, Mo. 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, Universitas. Postmaster: Send address changes to Universitas, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html Universitas is printed by Universal Printing Co. and mailed by Specialty Mailing. Worldwide circulation: 111,720 © 2006, Saint Louis University All rights reserved. Volume 3 2 , I ssue 3 In April, I had the privilege of speaking to a group of outstanding local citizens to accept St. Louis’ 2005 “Citizen of the Year” award, which is presented by a committee of former recip-ients and sponsored by the St. Louis Post-Dispatch. It was truly an honor. The humbling experience gave me the oppor-tunity to reflect on my early days in my adopt-ed hometown and how much I have seen things change here during the last 19 years. Although I had a very brief visit to St. Louis in 1967 on my way to Mexico to hone my Span-ish skills, I didn’t spend any time in the city until I was named to Saint Louis University’s board of trustees in 1983. On my first trip to SLU for a board meeting, I extended my stay so I could see the city. After taking the Lindell Boulevard bus downtown on a Saturday after-noon, I found so little to do that I caught an earlier flight back to Chicago. For four more years, I came to St. Louis for the trustees’ quarterly meetings — and I came only for the meetings. Then, in 1987, when I was elected president of SLU, I decided that I had to get to know the city. One Sunday morning shortly after my arrival, I took former SLU President Tom Fitzgerald’s old, green-colored Oldsmobile and drove around downtown, trying to memorize the street names. I saw progress. In four years, some things had certainly changed for the better. But as I drove back to campus, I saw that there was still much to do. Right in Midtown, in my own new back yard, there were dilapidated buildings, plots of asphalt and rundown city blocks. In my early days at SLU, I was like a new homeowner. I wanted the best for my neighborhood, and I was willing to make the effort to improve it. When I came to this city to live and work, I quickly adopted it as my home. But I still needed a shot of hometown pride. I found that pride away from buildings and ball clubs. I love St. Louis for more than its Arch, toasted ravioli and Ted Drewes frozen custard. I love it for the people who are trying to make a dif-ference — visionaries such as Joe Edwards and Richard Baron and many others. And while I did use my “Citizen of the Year” acceptance speech as an opportunity to challenge my fellow St. Louisans to aspire to make our city greater, I also know that I — and our University — have enjoyed unprec-edented cooperation from city officials and local business leaders. I can remember being here for just a few months and working with then-mayor Vince Schoemehl (Grad ’86) to get trees — substantial trees — planted along Grand and Lindell. In Chicago, I would have never had as much direct access to the Board of Aldermen or to the mayor himself. Today, we continue to receive tremendous support from Mayor Francis Slay (Law ’80) and from the Board of Aldermen. I am truly grateful for the trust that city officials have always placed in SLU. And it’s not just the civic leaders who have given us their trust. You, our alumni, friends and do-nors, have shown how you believe in us, too. Through your gifts of time, talent and treasure, you’ve been instrumental in building the reputation and stature of Saint Louis University. We’ve come a long way together. And the city of St. Louis has, too. I am so thankful for your commitment to Saint Louis University and hope that — no matter where you live now — SLU and St. Louis will always feel like home. Lawrence Biondi , S. J . photo by Steve Dolan President’s Message etrolink On the Map A special insert gives you an up-close look at SLU’s campus. Map Illustration by Robert North Jr. U N I V E R S I TA S S UMME R 2 0 0 6 Fr. Biondi with Dr. Donald Suggs, publisher of the St. Louis American and the 2004 Citizen of the Year. 2 On Campus Arena plans taking shape Research Building gets a name Commencement U.S. News ranks SLU high again Social justice magazine debuts 6 Billiken News Baseball team goes to the NCAA Tournament Walker is now a coach 7 Campaign Update Meet Anna and Jesse, students doing their part for annual giving 22 Class Notes Catch up with classmates 28 In Memoriam Remembering those members of the SLU community who recently died 29 Off the Shelf Seven books from the SLU community 30 Alumni Events Find SLU alumni activities wherever you live 32 Perspective An alumnus turns from music fan into record label owner 33 The Last Word Letters to the editor 9 Brothers in Song An introduction to the Bare Naked Statues, SLU’s all-male a cappella group. By Allison Babka Burney Bio-Diversity The biology department faculty are studying everything from fish to wasps to liver cancer. By Marie Dilg A Haven of Hope Two alumni have created a home where abused and neglected children thrive. By Marie Dilg 12 18 Students congregate around a fountain at the Medical Center on a hot June aftternoon. Photo by Kevin Lowder U N I V E R S I TA S w w w. s l u . e d u U N I V E R S I TA S S UMME R 2 0 0 6 Groundbreaking is less than three months away for the new 80.5millionSaintLouisUniversityArena.AtitsMaymeeting,theUniversitysboardoftrusteesgavetheauthorityforgroundbreakingtotakeplacebySeptemberfortheoncampus,multipurposeArena.AlsoinMay,SLUannouncedthatSt.LouisbasedClaycohasbeenchosentobuildtheArenaontheeasternendofcampus.Claycowilloverseeconstructionofa10,600seatbasketballArena,apracticefacilityandathleticdepartmentofficesandsupportfacilities.TheArenawillbehometoBillikenmensandwomensbasketballaswellasconcerts,familyshows,tradeshows,commencementsandmanyotherevents.PhiladelphiabasedGlobalSpectrumhasbeenselectedtomanagetheArenaandassistinpreopeningactivities.TheArenawillbefundedthroughfundraising,80.5 mil-lion Saint Louis University Arena. At its May meeting, the University’s board of trustees gave the authority for groundbreak-ing to take place by September for the on-campus, multipurpose Arena. Also in May, SLU announced that St. Louis-based Clayco has been chosen to build the Are-na on the eastern end of campus. Clayco will oversee construction of a 10,600-seat basketball Arena, a practice facility and athletic depart-ment offices and support facilities. The Arena will be home to Billiken men’s and women’s basketball as well as concerts, family shows, trade shows, commencements and many other events. Philadelphia-based Global Spectrum has been selected to manage the Arena and as-sist in pre-opening activities. The Arena will be funded through fund raising, 8 million in TIF funding and bonds, which will be paid off with revenues from the Arena. Fund raising continues toward the 39 million goal for the Arena project. Alumni and benefactors who would like to contribute to the Arena project can get information about the project online at arena.slu.edu, or by calling (314) 977-2499. Site preparation will begin this summer, with a groundbreaking date in late August or early September. Construction is expected to take approximately 19 months and be completed in March 2008. At 10,600 seats, the Saint Louis University Arena will have the second largest capacity in the Atlantic 10 Conference. The University anticipates hosting more that 90 events in the Arena in its first year of operation, with roughly half being non-University events. Arena plans move forward; groundbreaking soon Commencement 2006 Saint Louis University celebrated commencement for more than 1,700 graduates May 20 at Savvis Center. Chris Lowney, author of Heroic Leadership: Best Practices from a 450-Year-Old Company that Changed the World, delivered the com-mencement address. The book takes the pil-lars of Ignatian teachings and applies them to today’s business environment. In addition to Lowney, other honorary degree recipients were Maurice B. McNamee, S.J. (A&S ’33, Grad ’34, ’45), professor emeritus of Eng-lish, professor emeritus of art and art history and director emeritus of Samuel Cupples House; and Frank Stroble (Cook ’52, Grad ’60) and Ruth Stroble, longtime supporters of Catholic higher education and commu-nity volunteers. Throughout five decades as a professor at Saint Louis University School of Medicine, Dr. Edward A. Doisy was renowned worldwide for his pioneering work in the field of biochemistry, including win-ning the 1943 Nobel Prize for discovering the chemical nature of vitamin K. To honor his lifetime of work, SLU’s new biomedical research tower, a 67 million fa-cility, will be named the Edward A. Doisy Research Center. The Doisy family has com-mitted 30millionforconstruction.TheannouncementwasmadeduringaspecialtoppingoutceremonyJune9,duringwhichthebuildingsfinalsteelbeamwassecuredinplace.Faculty,staffandstudentswereinvitedtosignthebeambeforeitwasliftedtothetopofthestructure.TheceremonyalsofeaturedtheannouncementofseveralothermajorgiftstosupportboththeresearchbuildingandresearchattheSchoolofMedicine:30 million for construction. The announcement was made during a special topping-out ceremony June 9, dur-ing which the building’s final steel beam was secured in place. Faculty, staff and students were invited to sign the beam before it was lifted to the top of the structure. The ceremony also featured the announce-ment of several other major gifts to support both the research building and research at the School of Medicine: • 2 million to establish the James B. and Joan C. Peter Endowed Chair in Biochemistry and Molecular Biology. Dr. James B. Peter (Med ’58) is founder and former chief execu-tive officer of Specialty Laboratories, a hospi-tal- focused clinical reference laboratory. • 2 million to establish the Badeeh A. and Catherine V. Bander Endowed Chair in Ne-phrology. Dr. Steven J. Bander (A&S ’75), adjunct faculty member in nephrology, and his wife, Patricia, are endowing the chair in honor of his parents. • 1.5 million in a challenge grant from the J.E. and L.E. Mabee Foundation to sup-port construction of the research building. The building is expected to open in fall 2007. For more details, visit researchbuild-ing. slu.edu. Research building gets name and 30 million gift For the third consecutive year, U.S.News & World Report has named the Saint Louis University School of Law’s health law program the best in the na-tion. Since the rankings for the health law specialty began a decade ago, Saint Louis University’s Center for Health Law Studies never has been out of the top three. Overall, the magazine’s “Best Graduate Schools 2007” issue ranked the law school among the nation’s 180 accredited law schools. The School of Medicine was ranked No. 62 among the nation’s 144 research-intensive medical schools surveyed by U.S. News. The school’s geriatrics program was ranked 12th in the United States. In addition, the part-time MBA program in the John Cook School of Business was ranked No. 25 in the nation out of 347 part-time MBA programs accredited by the As-sociation to Advance Collegiate Schools of Business (AACSB). Graduate programs honored by U.S. News again Annual Atlas Week recognizes the University’s world view Through more than 50 special events, including discussions, open houses and student presentations, Atlas Week 2006 gave the Saint Louis University community the opportunity to ex-plore the international dimension of SLU’s academic programs and celebrate the University’s role in international education and service. The theme of this year’s Atlas Week, held in April, was “Political and Social Justice in a Global World.” The Signature Symposium featured Nobel Peace laureate Jody Williams, who led the passage of the international treaty banning antipersonnel landmines. Another highlight was a panel discussion commemorating the first anniver-sary of the death of Pope John Paul II. The Billiken World Festival, which featured a Parade of Nations, international cuisine, music, games and informational booths in the quadrangle, wrapped up the week. In SLU’s residence halls Students living on campus during the 2005-06 school year On-campus rooms Residence halls: Clemens, DeMattias, Fusz, Griesedieck, Marguerite, Notre Dame, Reinert and Walsh Apartment complexes: Grand Forest, the Language Houses, Marchetti East and West, and the Village Apartments 3,346 1,785 84 Severson wins teaching award Dr. John G. Severson Jr., professor of biology, received the 41st an-nual Nancy McNeir Ring Award from Alpha Sigma Nu, the Jesuit honor society. It is SLU’s oldest student-initi-ated teaching award and is named for the University’s first dean of women. Severson joined the faculty in 1971, has served as associate dean of the College of Arts and Sciences and led the Academic Services Center from 1993-2001. He played an in-tegral role in the development of the Pre- Law and Pre-Med Scholars programs, as well as SLU 101 and SLU 301 programs for new students. A view of the Arena facing northwest. A student shows her pride during the Parade of Nations. From left: The Strobles, McNamee and Lowney. Signing the beam before it is raised (from left): Alderman Michael McMillan; AT&T-Missouri vice president Debra Hollingsworth; U.S. Senator Christopher “Kit” Bond; Clayco president and SLU trustee Bob Clark; University President Lawrence Biondi, S.J.; SLU trustee Charles Drury and Shirley Drury, donors to the project. Photo by Kevin Lowder Photo by Clayton Berry Photo by Allison Babka Burney Photo by Allison Babka Burney Lincoln Legacy exhibit coming to SLUMA From Aug. 25-Dec. 17, Samuel Cupples House, in partnership with the Saint Louis University Museum of Art, will present “The Lincoln Legacy: Presidential Years.” The exhibit, which will be in the Judith and Adam Aronson Gallery at SLUMA, showcases the Dr. Bernard Hall Abraham Lincoln Collection of the University of Saint Mary in Leavenworth, Kan. It will feature manuscripts and autographed documents, as well as sig-nificant historical artifacts relating to Lincoln’s presidency. The exhibit is free and open to the public. In conjunction with “The Lincoln Legacy,” the University will be the site of a Civil War re-enactment, the “Camp Jackson Historic Encampment,” during Labor Day weekend, Sept. 1-3. For other programming and updates, visit http://lincoln.slu.edu or call (314) 977-2666. t h e A R T S a t S L U Hand-tinted woodcut of Lincoln (1863). MOCRA welcomes back ‘Silver Clouds’ They’re back! SLU’s Museum of Contemporary Religious Art (MOCRA) announces a final show-ing of its most popular show ever, Andy Warhol’s “Silver Clouds.” First shown at MOCRA in 2001 and 2002, the largest-ever U.S. “Clouds” instal-lation features dozens of silver mylar balloons riding the air currents around MOCRA’s capa-cious nave gallery. Visitors are invited to enter into a childlike world of wonder and experience one of Warhol’s groundbreaking experiments with creating unique, non-traditional environ-ments. MOCRA also will be showing a number of Warhol’s “Sunset” prints. The “Clouds” open in mid-September and continue through the fall semester. Call MOCRA at (314) 977-7170 or visit mocra.slu.edu for more information. “Silver Clouds” fill the gallery during the 2002 MOCRA showing. New administrators join SLU As of July 1, Dr. Kent Porterfield is Saint Louis University’s new vice president for student development. Porterfield comes to SLU from Northwest Missouri State Univer-sity, where he was vice president for student affairs — a role he held for nearly a decade. At SLU, Porterfield fosters student formation through non-academic areas, including residence life, student life, student health and counseling, campus recreation and community outreach. He also oversees contracted services such as the bookstore and dining services. At Northwest, Porterfield led many of these same areas and worked to enhance students’ lives. Dr. Connie Evashwick, previously an endowed chair and director of the Center for Health Care In-novation at California State University, Long Beach, joined SLU as dean of the Saint Louis University School of Public Health on July 1. Over the years, she has combined her academic career with consulting and direct operations management. Evashwick has served as vice president of long-term care for two major health care systems and is a national consultant to health systems, hospitals and long-term care organizations. She is the author or editor of 12 books and more than 100 other publications. News Briefs Saint Louis University again opened its doors to the area’s homeless population to provide a hot meal and clothing. During SLU’s annual “Open Doors” event March 23, hundreds of homeless individuals also received free employment and housing assistance, legal services and opportunities to pursue literacy education. SLU President Lawrence Biondi, S.J., and Dr. Ellen Harshman (Grad ’78, Law ’92), dean of the John Cook School of Business, were named to the St. Louis Business Journal’s “Influentials” list this spring. The list recognizes area business and community leaders who make a difference to the region. Biondi was honored as one of 10 “legends” — individuals “who have gone beyond being influential to become legends in our region and beyond.” Dr. Bruce R. Bacon, professor of internal medicine and director of the division of gastroenterology and hepatology at the School of Medicine, has been appointed to the National Commission on Digestive Diseases, an institute of the National Institutes of Health and the National Institute of Diabetes and Digestive Diseases. The commission, comprising 16 people, is charged with conducting an overview of research in digestive diseases and developing a strategic plan for the next 10 years of NIH digestive disease research. Saint Louis University Provost Dr. Joe Weixlmann was named “Distinguished Editor of the Year” by the Council of Editors of Learned Journals. The award recognizes Weixlmann’s dedication and excellence in his work with African American Review, the official publication of the Modern Language Association’s Division on Black American Literature and Culture. He was editor in chief from 1976-2004. The St. Louis Jesuits, sometimes called “the fathers of contemporary American liturgical music,” received an honorary doctorate of music from Creighton University this spring. Roc O’Connor S.J. (A&S ’73), Bob Dufford S.J. (A&S ’67, Grad ’72, ’75), John Foley S.J. (A&S ’68, Grad ’68, ’74), and Dan Schutte (A&S ’72), who were featured in the fall 2005 Universitas, were recognized for their 30 years of ministry to the Church. U N I V E R S I TA S w w w. s l u . e d u U N I V E R S I TA S S UMME R 2 0 0 6 Community service tops 750,000 hours Members of the Saint Louis University community continue to live the institution’s mission as 14,602 students, faculty and staff contributed 753,808 hours of com-munity service and outreach during 2005, according to a recently released University report. This is the second year in a row that members of the University have performed more than 750,000 hours of service. According to the report, more than 1,270 organizations and events benefited from SLU faculty and staff volunteerism, up from 1,110 in 2004. Faculty and staff spent 71,903 hours performing community service in 2005, a drastic jump from 41,533 hours previously. Student service also is intensive. Through academic courses, internships and campus organizations, students committed more than 76,768 hours to outreach. SLU students spend spring break in service During spring break in March more than 50 Saint Louis Uni-versity students participated in rebuilding efforts in New Orleans. Of the group, 39 SLU students assisted Ser-vice International with the demolition of buildings that were flooded or destroyed by Hurricane Katrina. After demolition, the students helped with power washing, sanitizing and rebuilding efforts. Another 15 SLU students worked with Operation Helping Hands, where they helped remove debris in neighborhoods and assisted with light carpentry, as well as construction and restoration of homes and buildings. This year, about 150 SLU students partic-ipated in spring break mission trips not only to New Orleans, but other U.S. locations as well as sites in Mexico and El Salvador. Social justice magazine debuts on campus Current SLU students from various cross-cultural and social justice groups on campus have collaborated to produce a student-led, student-run magazine that aims to raise aware-ness about international social justice issues. Based upon the Jesuit mission, One World focuses attention on men and women around the world who are in dire need of help. Whether it’s poverty and starvation in the developing world or genocide in Sudan, SLU stu-dent writers explore humanitarian issues in an effort to make read-ers realize that they have capacity and responsibility to get involved. To view the magazine online, visit www.sluoneworld.com. Or to order a copy of the 40-page magazine, send your request and 5 contri-bution to: One World c/o Donna Bess; Busch Student Center, Suite 237; 20 N. Grand Blvd.; St. Louis, MO 63103. Make checks payable to Saint Louis University. AHarvard University team recently won the Urban Land Institute Gerald D. Hines Student Urban Design Competition, which was held March 31 at Saint Louis Univ

    Universitas: the magazine of Saint Louis University

    No full text
    Fall 2008 issue of Universitas: the magazine of Saint Louis UniversityINSIDE: A Q&A with John Kavanaugh, S.J. page 12 Emergency Preparedness page 16 First Class of Presidential Scholars page 19 16 2 Volume 35, Issue 1 Editor Laura Geiser (A&S ’90, Grad ’92) Contributors Clayton Berry David Chilenski (Cook ’98) Marie Dilg (Grad SW ’94) Nick Sargent “On Campus” news stories University Communications Medical Center Communications Billiken Media Relations Design Art Direction: Matt Krob Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 221 N. Grand, St. Louis, Mo. 63103. We accept e-mail at utas@ slu.edu and fax submissions at (314) 977-2249. Address fax submissions to Editor, Universitas. Postmaster: Send address changes to Universitas, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html Universitas is printed by Universal Printing Co. and mailed by Specialty Mailing. Worldwide circulation: 118,600 © 2008, Saint Louis University All rights reserved. FALL 2004 WINTER 2005 Twenty years ago, I had just begun to settle in for my first year here at Saint Louis University when I challenged our board of trustees and administration team to create new ways for us to fulfill our mission of forming women and men for others. We knew that the Saint Louis University educa-tional experience was a unique opportunity, and we were striving to find a new way to attract students who not only were high-caliber academic scholars but also had the potential to become the type of leaders needed to improve our communities. Due to the generosity of alumni and SLU supporters, we were able to establish the Presi-dential Scholars program, which back in 1988, awarded the first 10 recipients with full schol-arships to Saint Louis University. In this issue of Universitas you will see how that investment continues to pay dividends for these 10 men and women and for the communities in which they live. I am blessed to have been at SLU long enough not only to witness the growth of this first class of Presidential Scholars during their years at SLU, but also now to see how they have grown and fulfilled the promise we saw in them two decades ago. Starting on page 19, you can read about this “first-class” group — an emergency room physician, owner of a social service agency, corporate lawyer, business analyst, piano teacher, researcher, pediatrician, manager for a home health care company and two alumnae serving their families as full-time mothers. Although they have settled on careers and homes that literally are all over the map, the members of the initial class of Presidential Scholars — much like the more than 300 Presidential Scholars who have followed them — show a commitment to service to others as well as an appreciation for the opportunities they received here at SLU. Their continued success is one of the best endorsements for the next generation of students who apply to Saint Louis University. And that’s one of the most important ways our original scholars are returning the invest-ment many SLU alumni and supporters made in them 20 years ago. We have great faculty, staff, researchers and alumni at Saint Louis University, but to keep SLU a great university, we need to continue to attract great students. All of you already are doing a wonderful job promoting Saint Louis University as you achieve success in your professional, personal and service lives. But I ask you to join your alma mater’s efforts to attract even more of tomorrow’s leaders to SLU. During the last academic year, SLU’s total enrollment increased 3 percent, and our goal is to continue to provide more opportunities for students who are eager to study at SLU. Even outside of St. Louis, many of you will see in movie theaters and hear on the radio a new SLU recruitment campaign, that encourages students to “Be a Billiken.” Using our Univer-sity’s unique mascot, the campaign highlights SLU’s equally unique attributes, which sepa-rate SLU from other top national schools. But your help, whether setting up one-on-one meetings with prospective students in your city or joining SLU recruiters at a college fair in your area, can make the difference in whether a student seriously considers SLU. If you’re interested in lending some of your valu-able time to the SLU recruitment cause, please contact our alumni relations office at alumni@ slu.edu for more information. I hope you enjoy reading about our 20th anniversary class of Presidential Scholars as much as I have enjoyed catching up with these 10 alumni. Lawrence Biondi, S.J., President SLU’s Presidential Scholarship celebrates its 20th anniversary. Photo by Jim Visser { president’s message } { contents } 8 | The Billiken: From Fad to Icon Learn how the Billiken came to be and how he came to SLU in this article celebrating the unique mascot’s 100 years. — By Nick Sargent 12 | Life, Hope and Homilies Philosophy professor John Kavanaugh, S.J., has been raising tough questions for more than 30 years. Now he gives some answers. — By Laura Geiser 16 | In Case of Emergency How well is SLU prepared for a crisis? A new emergency preparedness team is making sure the University is ready for anything. — By Clayton Berry 19 | Primary Scholars SLU’s inaugural class of Presidential Scholars arrived on campus 20 years ago. Find out where these 10 alumni are today. — By Marie Dilg 2 | On Campus Homecoming marks the Billiken’s birthday • New rankings released • Avian flu research • Heritage Hall • Art exhibits • Convocation 6 | Billiken News Basketball schedules • Trost on all- NCAA team • Volleyball wins big 7 | Advancement News A conversation with David Suwalsky, S.J., director of SLU’s museums and galleries. 24 | class notes Catch up with classmates. 28 | In Memoriam Remembering those members of the SLU community who recently died. 30 | alumni events Find SLU alumni activities wherever you live. 32 | Perspective A recent alumnus discusses the criminal justice system. 33 | the last word Letters to the editor. 8 19 12 features depar tments 6 2 U NI V E R S I T A S w w w. s l u . e d u U N I V E R S I T A S F A L L 2 0 0 8 3 { on campus } To celebrate the Billiken’s 100th year, the University threw two birthday celebrations to coincide with Homecoming and Family Weekend, which drew thousands of graduates and parents to campus Sept. 26-28. In all, more than 2,500 alumni and friends and 1,200 par-ents and family members made their way to SLU’s campus. The schedule of events included class reunions, jazz socials, campus tours and a St. Louis Cardinals baseball game. The birthday celebration kicked off in the Family Fun Area on Saturday, where alumni, parents and students turned out to make birthday hats, enjoy birthday-themed activities and eat cupcakes. The Billiken had only one wish for his birthday party: that all of his friends bring new children’s books, later donated to a special program at SSM Cardinal Glennon Children’s Medical Center. Almost 200 books were collected. The birthday celebration continued that night, as the men’s soccer team won its game against in-state rival Mis-souri State University by a 3-0 margin, with almost 5,800 in attendance. It was the second largest crowd in Hermann Stadium history. During halftime, the stadium lights dropped, and a three-tier cake was brought onto the field. The capacity crowd sang “Happy Birthday” to the Billiken. As soon as the song ended, a fireworks display erupted over the stadium. Homecoming Weekend also featured tours of the new Chaifetz Arena, the annual golf cart parade, a barbecue, Mass, brunch and a concert. “With wonderful events and spectacular weather, we really celebrated the Billiken’s birthday in style, and we are already looking forward to next year,” said Meg Connolly (A&S ’90, Grad ’92), associate vice president for alumni relations and annual giving. The 2009 Homecoming Weekend is scheduled for Sept. 25- 27. Call the office of alumni relations at (314) 977-2250 to help with reunion planning. Homecoming celebrates 100 years of the Billiken Scenes from this year’s homecoming This summer, two national publications recognized Saint Louis University as one of the best schools in the country for under-graduate education. U.S. News & World Report’s “America’s Best Colleges” ranks SLU 80th out of more than 260 national universities in the United States. The ranking placed SLU among the top five Jesuit universities in the country for the sixth consecutive year. U.S. News also gave high marks to the University’s undergrad-uate engineering and business programs. The Princeton Review’s 2009 edition of The Best 368 Colleges places SLU in the top 15 percent of America’s 2,500 four-year colleges. Listings in book are based on institutional data, school visits and feedback from students, independent college coun-selors and parents. However schools are chosen primarily for their outstanding academics. SLU earns U.S. News, Princeton Review honors Researchers study avian flu Saint Louis University School of Medicine has begun one of the larg-est avian flu clinical trials in the United States to test a new vaccine approach to prevent the disease. The study tests whether an injection of an FDA-approved avian flu vaccine created in 2004 can prime the body’s immune system so a second shot of a different avian flu vaccine can protect against avian flu infection. Public health experts are concerned that the avian flu could become the next influenza pandemic because bird viruses have started previous outbreaks. The study will examine the vigor of the body’s antibody response and the safety of the vaccines. SLU is the lead site of the research, which is sponsored by the National In-stitute of Allergy and Infectious Diseases, part of the National Institutes of Health, and will include up to five study sites. SLU named a great place to work In its “2008 Great Colleges to Work For” issue, The Chronicle of Higher Education recognized Saint Louis University as one of the best universities to work for in the nation. SLU was one of five institutions of higher education with 2,500 or more employees recognized in the following categories: Teaching Environment: Faculty members say the institution recognizes innova-tive and high-quali-ty teaching. Tenure Clarity and Process: Requirements for tenure are clear, faculty members say. Housing Assistance Programs: The “Hometown SLU” program provides forgiv-able loans toward homes purchased in neighborhoods near the University. 403(b) or 401(k): Saint Louis University offers an award-winning retirement plan. New endowed chair benefits ophthalmolo g y Dr. Anwar Shah, a former SLU faculty member, has established an endowed chair in ophthalmology. Shah began his relationship with SLU as an intern and resident in ophthal-mology, after coming to the United States from Pakistan as a Fulbright Scholar in 1955. After completing fellowships at Washington University in St. Louis and Harvard Medical School, Shah became director of retina services in SLU’s department of ophthalmology. He was a member of the SLU faculty for years, training numerous ophthalmology residents. In 1980, he built the St. Louis Eye Hospital, a 5millionnonprofitproject,whichwaslateracquiredbySt.MarysHospital.ShahnowlivesinCalifornia.Dr.Shahsgenerousgiftallowsustheopportunitytorecruitanationallyrecognizedretinalresearcherandaccomplishededucator,saidDr.OscarA.Cruz,chairmanofSLUsdepartmentofophthalmology.Dr.AnwarShah100yearsofwomenatSLUIn1908,fivewomenmadehistoryatSaintLouisUniversitySchoolofLawwhentheybecamethefirstwomenstudentsinthehistoryoftheUniversity.Tocelebratethefirst100yearsofwomenatSaintLouisUniversity,theSchoolofLawishostingaseriesofspeakersfocusingonissuesfacingwomeninthelegalprofession.Visitlaw.slu.edu/conf/womenforalistofupcomingspeakers.PhotosbySteveDolanNewsBriefsInJuly,TimBrookswasnamedtheUniversitysvicepresidentandchiefinformationofficer.Inhisnewrole,BrooksoverseesalloftheUniversitysinformationtechnologyfunctions.SinceNovember2007,BrookshadservedasSLUsqualityassuranceadministrator.Dr.PhilipAlderson,deanoftheSchoolofMedicineandanationallyrecognizedradiologist,hasbeennamedtotheadvisorycouncilfortheNationalInstituteofBiomedicalImagingandBioengineering,oneoftheNationalInstitutesofHealth.Spanningmorethanthreedozenspecialties,124doctorsfromSLUCarehavebeenselectedforSt.LouisMagazines2008BestDoctorslist.ThelistisbasedontheannualBestDoctorsinAmericadatabase,whichconsidersmorethanonemillionpeerevaluationstocreateadirectoryofapproximately30,000doctors.JeanGilmanisthenewdeanofundergraduateadmission,managingallofthedaytodayactivitiesofundergraduaterecruitment.Previously,shewasthedirectoroftheofficeofrecruitmentatMarshallUniversity.Dr.RaymondSlavin(Med56),professorofinternalmedicineandmolecularbiologyandimmunologyandamedicalschoolfacultymemberfor43years,receivedaLifetimeAchievementaward,thehighesthonorgivenbytheSt.LouisBusinessJournalatitsHealthCareHeroesrecognitionceremonyinOctober.Dr.MarlaBergWeger,seniorassociateprovostofacademicaffairs,nowalsoisthedeanoftheSchoolforProfessionalStudies.SheformerlyservedasinterimdeanoftheCollegeofEducationandPublicService.SLUs2008RelayforLifetobenefittheAmericanCancerSociety,heldinApril,wasrecognizedassecondlargestcollegiateeventinthenationpercapita.ThismarksthethirdconsecutiveyearthatSLUseventhasplacedinthetopfiveinthenation.SLUparticipantsraisedmorethan5 million nonprofit project, which was later acquired by St. Mary’s Hospital. Shah now lives in California. “Dr. Shah’s generous gift allows us the opportunity to recruit a nationally recognized retinal researcher and accomplished educa-tor,” said Dr. Oscar A. Cruz, chairman of SLU’s department of ophthalmology. Dr. Anwar Shah 100 years of women at SLU In 1908, five women made history at Saint Louis University School of Law when they be-came the first women students in the history of the University. To celebrate the first 100 years of women at Saint Louis University, the School of Law is hosting a series of speakers focusing on issues facing women in the legal profession. Visit law.slu.edu/conf/women for a list of upcoming speakers. Photos by Steve Dolan News Briefs In July, Tim Brooks was named the Univer-sity’s vice president and chief information of-ficer. In his new role, Brooks oversees all of the University’s information technology functions. Since November 2007, Brooks had served as SLU’s quality assurance administrator. Dr. Philip Alderson, dean of the School of Medicine and a nationally recognized radiolo-gist, has been named to the advisory council for the National Institute of Biomedical Imaging and Bioengineering, one of the National Insti-tutes of Health. Spanning more than three dozen special-ties, 124 doctors from SLUCare have been selected for St. Louis Magazine’s 2008 “Best Doctors” list. The list is based on the annual “Best Doctors in America” database, which considers more than one million peer evalu-ations to create a directory of approximately 30,000 doctors. Jean Gilman is the new dean of undergradu-ate admission, managing all of the day-to-day activities of undergraduate recruitment. Previously, she was the director of the office of recruitment at Marshall University. Dr. Raymond Slavin (Med ’56), professor of internal medicine and molecular biology and immunology and a medical school faculty member for 43 years, received a Lifetime Achievement award, the highest honor given by the St. Louis Business Journal at its Health Care Heroes recognition ceremony in October. Dr. Marla Berg-Weger, senior associate pro-vost of academic affairs, now also is the dean of the School for Professional Studies. She formerly served as interim dean of the College of Education and Public Service. SLU’s 2008 Relay for Life to benefit the American Cancer Society, held in April, was recognized as second largest collegiate event in the nation per capita. This marks the third consecutive year that SLU’s event has placed in the top five in the nation. SLU participants raised more than 160,000. 4 U NI V E R S I T A S w w w. s l u . e d u U N I V E R S I T A S F A L L 2 0 0 8 5 CONVOCATION CELEBRATION For the first time, in August Saint Louis University’s annual convocation to welcome new students and their families to the SLU community was held at Chaifetz Arena. Previously held in St. Francis Xavier College Church, convocation moved to the arena this year to allow more faculty and staff to participate in the event. { on campus } Viewing Heritage Hall on the day of its dedication are (from left): Dr. Patricia Demuth, former coordinator of gerontological nursing at the School of Nursing; Sister Noreen McGowan (seated), former faculty member and director of nursing at Cardinal Glennon Children’s Hospital; and Virginia Patton Spe-noga, former faculty member. Nursing School marks anniversary with Heritage Hall installation When Saint Louis University School of Nursing marked its 80th anniversary by unveiling its Heritage Hall, one sec-tion was left empty by design. “Visitors to Heritage Hall will learn of the many greats we have achieved as an innovator in nursing education. But the best is yet to come,” said Dr. Teri Murray (Nurs ’79, Grad ’93, ’97), dean of the School of Nursing. Located on the second floor of the School of Nursing Building, Heritage Hall is a three-dimensional timeline of the School of Nursing’s milestones. It was dedicated Sept. 27. A seed donation for Heritage Hall was made in honor of Dr. Joan Carter (Nurs ’58, Grad ’62), associate dean emerita of the School of Nursing. Alumni and other friends of the School of Nursing contributed to the historical remembrance. Faculty from Saint Louis University’s Doisy College of Health Sciences and the department of nutrition and dietetics’ Fresh Gatherings cafeteria are featured in a book by author Patricia Corrigan called Eating St. Louis: The Gate-way City’s Unique Food Culture. The hardcover book serves up stories and photos of the places, people and foods that have come to define and feed St. Louis. It also features little-known tales about local restaurants, food manufacturers, groceries and specialty food shops. Eating St. Louis can be ordered online at: www. eatingstlouis.com. Doisy College featured in book Rec Center reminder Whether you’re a member of SLU’s Simon Recreation Center or not, alumni may enroll in most of the center’s fitness classes, including Pilates, yoga, aerobics, spinning, kickboxing, bouldering and swimming. Several dance classes also are offered. There is a moderate fee for class enrollment, and all skill levels are welcomed. Classes and schedules vary, so visit www.slu.edu/ organizations/crcisc for details or call (314) 977-3969. As the Billiken celebrates his 100th birthday Issues of Universitas that feature the Billiken on the cover (including this one) NCAA Division I Billiken teams at SLU Billiken statues on campus (plus, there’s a Billiken-shaped topiary) Individuals inducted into SLU’s athletic Billiken Hall of Fame Pageviews of SLU’s “What’s a Billiken?” page (www.slu.edu/billiken.xml) during the last three months 8 18 2 227 5,397 t h e A R T S a t S L U SLUMA shows ‘Diebenkorn, Hockney and Dine’ works The Saint Louis University Museum of Art is present-ing “Diebenkorn, Hockney and Dine: Selected Prints from the Bank of America Collection.” This iconic trio of contemporary artists is represented by more than 100 of their respec-tive prints spanning the period between 1950 and 1986. The works on paper reveal explorations into the aesthetics of line, color and formal complexity. SLUMA’s hours are 11 a.m. to 4 p.m., Wednesday through Sun-day. For more information, visit sluma.slu.edu. MOCRA’s ‘Pursuit of the Spirit’ marks 15 years This fall, visitors to SLU’s Museum of Contemporary Religious Art can view the exhibition “Pursuit of the Spirit,” which draws on art-ists and artworks selected from the museum’s first 35 exhibitions. As the museum celebrates its 15th an-niversary, the selections are dedicated to the ongoing dialogue between con-temporary artists and the world’s faith traditions. The museum is open 11 a.m. to 4 p.m., Tuesday through Sunday. For more informa-tion, call (314) 977-7170 or visit mocra.slu.edu. Campaign memorabilia on display at SLUMA The Saint Louis University Museum of Art is exhibit-ing “Persuasive Politics: Presidential Campaign Memorabilia.” Centuries of presidential memorabilia are showcased in the collec-tion: a George Washington coat button, an “I Like Ike” cigarette pack and an 1860 Abraham Lincoln campaign coin are among the more than 700 campaign items, ranging from the historic and stoic to the contemporary and whimsical. SLUMA’s hours are 11 a.m. to 4 p.m., Wednesday through Sun-day. For more information, visit sluma.slu.edu. Madonna and Child. Frederick J. Brown (1994-95), oil and mixed media on canvas. McKinley campaign pin with flag ribbon. Clubs-Blue Ground. Richard Diebenkorn (1982), etching, spitbite aquatint, drypoint. Public Health receives 26millioncontractTheNationalChildrensStudy,thelargeststudyeverconductedtolearnaboutthehealthanddevelopmentofchildren,hasselectedSLUsSchoolofPublicHealthtohelpexpanditsfootprintintheregion.ChildrenfromJeffersonCountyinMissouriandJohnson,UnionandWilliamsoncountiesinsouthernIllinoiswillbeamong100,000childrenacrossthenationwhomresearcherswillfollowfrombeforebirthtoage21tolearnmoreaboutenvironmentalandgeneticinfluencesondiseases.Astheleadstudysite,theSchoolofPublicHealthreceiveda26 million contract The National Children’s Study, the largest study ever conducted to learn about the health and development of children, has selected SLU’s School of Public Health to help expand its footprint in the region. Children from Jefferson County in Missouri and Johnson, Union and Williamson counties in southern Illinois will be among 100,000 children across the nation whom researchers will follow from before birth to age 21 to learn more about environmental and genetic influences on diseases. As the lead study site, the School of Public Health received a 26.3 million contract from the National Institutes of Health, the Centers for Disease Control and Prevention and the U.S. Environmental Protection Agency. The new contract is in addition to last year’s $26.8 million, five-year contract to the School of Public Health to follow the health of children from St. Louis City and Macoupin County in Illinois. FIRST CLASS This fall, Saint Louis University debuted a new classroom building at 3721 Laclede Ave. The building, which was the former home of Forest Pharmaceuticals, was completely gutted and renovated this summer. Now known as the Laclede Classroom Building, the fa-cility boasts 15 classrooms, a new forensics/anthropol-ogy lab and several seminar rooms. Photo by Steve Dolan Photo by Steve Dolan Photo by Kevin Lowder date opponent place time Nov. 05 vs. Harris-Stowe State St. Louis 7 p.m. (ExhIBITION) Nov. 14 vs. Missouri-St. Louis St. Louis 7 p.m. Nov. 19 vs. Kent State St. Louis 7 p.m. Nov. 22 vs. Boston College St. Louis 1 p.m. Nov. 25 at Nebraska Lincoln, Neb. 7 p.m. Nov. 29 at Detroit Mercy Detroit 1 p.m. Dec. 02 at Southern Illinois Carbondale, Ill. 7 p.m. Dec. 06 vs. Savannah State St. Louis 7 p.m. Dec. 13 vs. Samford St. Louis 4 p.m. Las Vegas Classic Dec. 17 vs. USC Upstate St. Louis 7 p.m. Dec. 19 vs. Liberty St. Louis 7 p.m. Dec. 22 vs. DePaul Las Vegas 7 p.m. Dec. 23 Las Vegas Classic Las Vegas 6:30 or Championship 9 p.m. Dec. 30 vs. UMBC St. Louis 8 p.m. Jan. 02 vs. North Carolina A&T St. Louis 7 p.m. Jan. 08 at Xavier Cincinnati 7 p.m. Jan. 14 vs. Massachusetts St. Louis 7 p.m. Jan. 17 vs. George Washington St. Louis TBA Jan. 22 at Temple Philadelphia 7 p.m. Jan. 25 vs. Richmond St. Louis 2 p.m. Jan. 29 at Dayton Dayton, Ohio 7 p.m. Jan. 31 at Fordham Bronx, N.Y. 6 p.m. Feb. 04 vs. Duquesne St. Louis TBA Feb. 08 at Richmond Richmond, Va. 1 p.m. Feb. 11 vs. Charlotte St. Louis 7 p.m. Feb. 14 at Rhode Island Kingston, R.I. 1 p.m. Feb. 1

    Universitas: the magazine of Saint Louis University

    No full text
    Summer 2018 issue of Universitas: the magazine of Saint Louis University. This is a special Bicentennial issue, celebrating the University's 200th anniversaryUNIVERSI TAS 2 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 1 BICENTENNIAL P R E S I D E N T ’ S M E S S A G E VOLUME 4 4, ISSUE 2 EDITOR Laura Geiser (A&S ’90, Grad ’92) ASSOCIATE EDITOR Amy Garland (A&S ’97) ART DIRECTOR Matt Krob CONTRIBUTORS Anne Marie Apollo-Noel Dr. Dolores Byrnes Molly Daily (Grad A&S ’18) Marie Dilg (Grad SW ’94) Sarah Hilgendorf ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER Detail of a window in St. Francis Xavier College Church depicting the north entry of DuBourg Hall flanked by graduates. The word “Christocracy” in red letters above the entry indicates Christ’s influence on education. The window was designed by Emil Frei Jr. and installed in the 1930s. Photo by J.J. Mueller, S.J. (A&S ’69, Grad A&S ’70) Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, One N. Grand Blvd., St. Louis, MO 63103. We accept email at [email protected]. Postmaster: Send address changes to Universitas, Saint Louis University, One N. Grand Blvd., St. Louis, MO 63103. Website: slu.edu/universitas Universitas is printed by Henry Wurst Inc. Worldwide circulation: 116,500 © 2018, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. Detail of two windows in St. Francis Xavier College Church that spotlight academic disciplines and sit on each side of the window on this issue’s cover. On the left, painting and music are depicted. On the right, mathematics and science are shown. PHOTOS BY J.J. MUELLER, S.J. PHOTO BY JAY FRAM F E ATU R E S D E PARTME NTS 10 The First Two Centuries A 200-year timeline of Saint Louis University — By Molly Daily 16 Always at the Frontier An excerpt from the official bicentennial book — By Dr. Dolores Byrnes 20 Exhibiting History The Saint Louis University Museum of Art’s new exhibition — Photos by Steve Dolan 24 Talking About My Generation Campus activities and hangouts since the 1940s — By Amy Garland 29 The Bicentennial Logo The hidden details of SLU’s 200-year mark — Designed by Matt Krob 30 More Than a Job Reflections from 10 longtime faculty and staff — By Marie Dilg 36 Cover Story Telling SLU’s history through its alumni magazines — By Laura Geiser 40 Making Good Time An update on the bicentennial service challenge — By Anne Marie Apollo-Noel 2 On Campus Major gift to the business school /// Madrid’s 50-year celebration /// 2018 commencement /// Climate Summit /// Prospect Yards /// Gift for nursing scholarships /// Literary Award to Sondheim 42 Class Notes 43 Alumni Spotlight Eric Moraczewski (CSB ’04) 46 In Memoriam 48 Feedback 49 The Last Look Our beloved University is worthy of celebration — both for the memorable achievements of our shared past and for the many impressive ways in which we live our mission today. We began this past academic year with the bicentennial Mass. As we planned it, I believed that it would be remembered as one of the very best moments in our history. An email I received from a parent of one of our students confirmed that to me. He said, “As I sat at the 200th anniversary Mass, with its gorgeous backdrop and significant history, I was brought to tears by the humbling appreciation that my daughter could attend a university like SLU.” This gratitude for SLU and our his-tory set the tone. More recently, as part of our bicentennial celebration, we hosted the Saint Louis Climate Summit and brought together world-re-nowned speakers Cardinal Peter Turkson, Dr. Mario Molina, Carl Pope and Bill Nye to examine a path forward for our planet. (Read more on page 5.) The Climate Summit was born out of the desire to respond to Pope Francis’ call to care for all of creation, especially our environ-ment, in his encyclical Laudato Si’. Chaired by SLU’s own Dr. Jack Fishman (Grad A&S ’74, ’77) and David Webb (A&S, CSB ’97, Grad ’12), and planned with support from Dr. Peter Raven and trustee Trudy Busch Valentine (Nurs ’80), the summit attracted meteorol-ogists; government leaders; experts in climate science, ecology and sustainable development; students; and engaged St. Louisans for three days of discussion. In affirmation of this summit, I received a letter from Cardinal Pietro Parolin, who is the secretary of state for the Vatican. In the letter, Cardinal Parolin quotes Pope Francis’ prayer that, “This gath-ering may serve to inform society more effectively on the issue of climate change and encourage the University community ‘to pro-mote best practice, to stimulate creativity in seeking new solutions and to encourage individual or group initiatives.’” In addition to these and other impressive events and academic programs, our bicentennial has inspired an outpouring of support from our community. Our stakeholders are demonstrating their belief in the importance of our work by investing in SLU. We are in the midst of the single greatest fundraising year in SLU history. Further, we are confident we will end this year at more than twice our previous all-time total. This February, trustee Dr. Richard Chaifetz (A&S ’75) and Jill Chaifetz made a transformational gift of 15milliontoourbusinessschool,bringingtheirlifetimecontributionstoSLUto15 million to our business school, bringing their lifetime contributions to SLU to 27 million. Their latest gift is intended to grow SLU’s nationally ranked entre-preneurship center and provide resources for other programs in the newly named Richard A. Chaifetz School of Business. (Read more on page 2.) Thank you to each of our alumni who have contributed to this historic fundraising year. Your gifts support innovation, academic excellence, scholarship and informed medicine. They will invigo-rate Saint Louis University, and reflect your confidence in our plan for the future. The very near future holds two outstanding opportunities for all of us to come together to celebrate SLU’s first two centuries. I hope you will join us for a Grand Celebration on Saturday, Sept. 29, during our special bicentennial Homecoming and Family Weekend. This evening will feature live music, food and fun activities for all ages. And on Thursday, Nov. 15, I invite you to a 200th birthday celebration featuring a private concert by the St. Louis Symphony Orchestra at Chaifetz Arena. As we all celebrate this historic milestone, our University is part-nering in shaping the direction of our region, and we are doing wonderful work in the classroom, in the laboratory, in the hospi-tal and in the community. Your support during our past and in the present is vital to our future. While you read, I hope you’ll learn new facts about your alma mater, reminisce about your time here and be inspired by the stories of those who shaped our beloved institu-tion. I would be delighted to hear your reflections. May God bless you, and may God continue to bless Saint Louis University. Dr. Fred P. Pestello President This special issue of Universitas takes you on a journey though Saint Louis University’s past. The timeline, book excerpt, faculty memories and photos that you will find on the following pages all serve to remind you of SLU’s noble history. UNIVERSI TAS 2 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 3 BICENTENNIAL Chaifetz Family Gift Leads to Business School’s New Name In February, SLU trustee Dr. Richard A. Chaifetz (A&S ’75) and his wife, Jill Chaifetz, increased their giving to Saint Louis University to 27million,including27 million, including 15 million to the business school. In 2007, the couple provided the lead gift of 12 million that enabled the construction of Chaifetz Arena. To honor this new, generous contribution, the University has renamed its business school the Richard A. Chaifetz School of Business and the school’s entrepreneurship center the Chaifetz Center for Entrepreneurship. SLU students, faculty and staff members turned out to thank Chaifetz during a special reception on Feb. 22. In his remarks, Chaifetz briefly told the story of how former SLU President Paul Reinert, S.J., allowed him to remain at SLU when financial issues threatened his ability to stay. Chaifetz promised Reinert that he would pay back his tuition — and that he would pay back the University in an even bigger way in the future. “This allows me to give back to a school I love, am passionate about and want to make even greater,” Chaifetz told the large crowd. “I want to hear the Chaifetz School of Business mentioned in the same breath as other great business schools.” The Richard A. Chaifetz School of Business has seven programs nationally ranked by U.S. News and World Report — three undergraduate and four graduate — including the country’s No. 9-ranked undergraduate entrepreneurship program. Chaifetz is a world-renowned entrepreneur and business leader, who in 1984 founded ComPsych Corp., today the world’s largest provider of employee assistance programs, behavioral health and wellness services. The company, of which he remains founder, chairman and CEO, provides services to more than 100 million individuals and 45,000 organizations in more than 160 countries. He also is founder and chairman of the private investment firm Chaifetz Group. He has been a member of SLU’s board of trustees since 2007 and was an inaugural member of the business school’s Entrepreneurial Hall of Fame. ON C AMPUS PHOTOS BY STEVE DOLAN Chaifetz addresses the crowd. Chaifetz (left) and SLU President Dr. Fred P. Pestello talk with students at the February event. Guests gathered in the in the Shanahan Atrium of Cook Hall listen to Chaifetz. UNIVERSI TAS 4 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 5 BICENTENNIAL 2018 Commencement Celebrates the Bicentennial With SLU’s bicentennial in mind, the University began a new tradition at the May 19 com-mencement ceremony at Chaifetz Arena as members of its Class of 1968 — now called Golden Billikens — led the entry procession and received special recognition. Golden Billikens will be honored at University commencements going forward. In another nod to the bicentennial, SLU reintro-duced its “Varsity Song,” which was written in 1909 and had not been performed at commencement since the 1960s. (See the original on page 19.) It was updated by Dr. Aaron Johnson, assistant professor of music, and sung by the University’s Mastersingers. More than 2,100 students graduated this spring. This year’s commencement speaker was Ronald Mercier, S.J., provincial of the Jesuits’ U.S. Central and Southern Province. He received an honorary doctor of divinity from the University. Also honored with honorary degrees during the ceremony were two SLU alumni, former U.S. Congressman William “Bill” Lacy Clay Sr. (A&S ’53) and former St. Louis Mayor Francis G. Slay (Law ’80). The student speaker from the graduating class was new law alumna Sarah Tomlinson. University archi-vist emeritus John Waide (A&S ’73) was the mace bearer. Climate Summit Draws Thousands Saint Louis University brought toge t her some of the most author-itative minds in climate science, ecology and sus-tainable development for the 2018 Saint Louis Cl imate Summi t thi s April. A highlight of SLU’s yearlong bicentennial celebration, the three-day summit was inspired by Pope Francis’ 2015 encyclical Laudato Si’ that called attention to humankind’s responsibility to care for the earth in the wake of climate change. Nearly 2,300 students, faculty and members of the St. Louis community attended the summit’s keynote address at Chaifetz Arena. The speakers were Carl Pope, former executive director of the Sierra Club and co-author of Climate of Hope: How Cities, Businesses and Citizens Can Save the Planet, and Bill Nye “The Science Guy,” well-known science educator and advocate. The summit featured experts from around the world, including Cardinal Peter Turkson, prefect of the Dicastery for Promoting Integral Human Development; Dr. Mario Molina, 1995 recipient of the Nobel Prize in Chemistry; recipients of various United Nations Environmental Awards; and members of the Pontifical Academy of Sciences, the primary scientific advisory council to the pope. Panelists presented about food security, water availability, rising sea levels, busi-ness issues related to climate change and more. More than 220 people attended the academic portion of the summit, which was shared worldwide online. The summit was organized by Dr. Jack Fishman (Grad A&S ’74, ’77), professor of earth and atmospheric sciences and director of SLU’s Center for Environmental Sciences, and David Webb (A&S, CSB ’97, Grad ’12), director of SLU’s Emerson Leadership Business Institute. Dr. Peter Raven, president emeritus of the Missouri Botanical Garden, and Trudy Busch Valentine (Nurs ’80), a SLU trustee, were key members of the planning team. During February and March, SLU competed in the annual nationwide RecycleMania competition, an eight-week event that raises awareness about campus sustainability. 8th year participating in RecycleMania 331,762 lbs. of single-stream recycling collected by SLU 86,267 lbs. of electronics collected during the E-Waste Drive 4th place in the national electronic recycling competition 25,721 lbs. of old documents shredded and recycled during ShredMania event 443,750 lbs. total diverted from landfills by SLU this RecycleMania IN ADDITION TO THE CLIMATE SUMMIT, HERE ARE A FEW HIGHLIGHTS OF THIS SPRING’S BICENTENNIAL EVENTS: O N C A M P U S BY THE NUMBERS RecycleMania Students volunteer at March’s E-Waste Drive, part of the national RecycleMania competition. SUBMITTED PHOTO Nye (left) and Pope give the keynote address at Chaifetz Arena. PHOTO BY SIMON NGUYEN INTERCULTURAL ORIGINS OF ST. LOUIS AND THE TRANS-MISSISSIPPI WEST, 1800-1840 This conference examined themes including the international influences present in early St. Louis, and the expansion of the St. Louis region. WOMEN AT SLU: THE STRUGGLE FOR KNOWLEDGE, POWER AND LEGACY This symposium discussed both the challenges and opportunities women confront as female students, staff and faculty at SLU. FROM SELMA TO ST. LOUIS: THEOLOGY OF MARTIN LUTHER KING JR., AND THE PURSUIT OF JUSTICE 50 YEARS LATER This public symposium offered performances and reflections on King’s legacy of liberation and justice. PHOTO BY SIMON NGUYEN Turkson (left) and Molina Confetti and streamers were released at the end of the ceremony in Chaifetz Arena. Graduates’ caps Honorary degree recipients (from left) Slay, Mercier and Clay Doisy College of Health Sciences graduates PHOTOS BY STEVE DOLAN UNIVERSI TAS 6 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 7 BICENTENNIAL SLU, St. Louis Archdiocese Sign Agreement to Enrich Seminarian Education St. Louis Archbishop Robert J. Carlson and SLU President Dr. Fred P. Pestello signed an agree-ment in April that brings the Kenr ick-Glennon Seminary undergraduate program fully into SLU’s College of Philosophy and Letters, which oversees pro-grams for students training for the priesthood and ministry. Currently, seminarians take their first two years of undergraduate classes at SLU and finish their education at the seminary, receiving a degree from Kenrick- Glennon Seminary. Under the new agreement, seminarians will receive a Bachelor of Arts degree in philosophy from SLU, taking classes taught both at SLU and at the seminary. The program changes will be implemented for the 2018-19 school year. The seminarians will be able to explore other disciplines while at SLU. Carlson said he hoped that many would take advantage of the language arts and minor in Spanish, as the archdiocese has a growing Spanish-speaking population. Graduate Programs Earn High U.S. News Rankings The health law program in the Saint Louis University School of Law has been named the best in the nation by health law scholars for the 14th year, according to the 2019 U.S. News & World Report “Best Graduate School” rankings. The Center for Health Law Studies has been listed as a top program since the rankings were first published. Four programs in the Richard A. Chaifetz School of Business were ranked in the top 30 this year, including entrepreneurship, international business, supply chain management and accounting. SLU School of Nursing’s master’s program ranked among the top 50 out of more than 500 nursing graduate programs in the country. 1 Health Law 12 Entrepreneurship 13 International Business 15 Supply Chain Management 28 Accounting 28 Part-time Law 50 Best Nursing Programs – Master’s 51 Best Medical Programs – Primary Care 66 Best Nursing Programs – Doctor of Nursing Practice 70 Best Medical Programs – Research 88 Best Law Programs 163 Part-time MBA 194 Top Education Programs Atlas Week Celebrates SLU’s Global Connections The 2018 Sam and Marilyn Fox Atlas Week — “From Broken Walls, We Build Bridges: Out of Conflict Rises Community” — paid special attention to the ways that SLU students, faculty and staff members have forged connections beyond campus to improve the world. The week featured panels, presentations, film screenings, a soccer tournament, and other opportunities to experience the myriad cultures that make up the SLU community. A highlight was the keynote address by brothers Fred and Milton Ochieng’. Fred is pursuing cardiovascular medicine fellowship training at Saint Louis University; Milton is a gastroenterologist with the BJC Medical Group at Progress West Hospital. They spoke of their paths from their Kenyan community Lwala to medical school in the United States and beyond. The pair was orphaned and has used their medical educations to give back to Lwala through the creation of a community health clinic network. The week culminated with the traditional Parade of Nations and the Billiken World Festival. Ring Award Winner Dr. Lauren Arnold, associate professor of epidemiology in the College for Public Health and Social Justice, is the most recent recipient of the Nancy McNeir Ring Award, given by SLU’s chapter of Alpha Sigma Nu to a faculty member who has displayed a special dedication to students. Arnold addressed graduates during Midyear Commencement in December. In her address, she reminded the graduates to find joy in their decisions and to find good mentors Newly Named “Prospect Yards” District Connects SLU’s North and South Campuses In March, members of the Saint Louis University family, SSM Health and the community cast nearly 6,000 votes to name St. Louis’ newest district. The win-ning name? Prospect Yards. The 150-acre district connects SLU’s north and south campuses and is bordered by Laclede Avenue, Chouteau Avenue, Grand Boulevard and Vandeventer and Spring avenues. The district lies within Midtown in the same way that Cortex is part of St. Louis’ Central West End neighborhood and the Loop is part of University City. Prospect Yards includes projects such as the construction of the City Foundry STL and an Element by Westin hotel, as well as redevelopment of the Armory building. The name reflects the area’s early 20th-century roots, when the area west of Grand was known as the “Prospect Industrial District,” one of 17 industrial districts in the city and home to an extensive rail yard and many businesses. The umbrella developer for the larger, 400-acre area is St. Louis Midtown Redevelopment Corporation, which is owned by Saint Louis University and SSM Health. Stephen Sondheim Named 2018 St. Louis Literary Award Recipient The Saint Louis University Library Associates selected Stephen Sondheim, one of the most eminent lyricists and composers of the modern era, to receive the 2018 St. Louis Literary Award. He is the first musical lyricist to win the award since its inception in 1967. Sondheim will come to SLU in October to accept the award. In a career spanning 70 years, Sondheim has writ-ten the lyrics, music or both for some of the most iconic plays in the history of American theater, including West Side Story, Into the Woods, Sunday in the Park with George, Sweeney Todd and Gypsy. The award ceremony and conversation with the author, who will be interviewed by Muny artistic director Michael Isaacson (A&S ’86, Grad CSB ’96), is planned for Oct. 4. For more information, visit lib.slu.edu/about/associates. Med School Residency Program Receives Highest Accreditation Status The Accreditation Council for Graduate Medical Education, the accrediting body for medical residencies and fellowships, granted the School of Medicine continued accreditation, its high-est accreditation status. The status took effect Jan. 24, after a site visit earlier in the month. SLU is the sponsoring institution for 65 residency and fellowship programs at six area hospitals and many other clinical sites. 8.4 Million Gift to Nursing School Abequest gift totaling $8.4 million will allow the School of Nursing to create the Dr. and Mrs. Robert C. Hoppe Endowed Scholarship. The gift — the largest in the School of Nursing’s history and among the largest in SLU’s history — was made by the estate of Mary K. Hoppe (Nurs ’51, Grad Nurs ’59). “The Hoppes’ generosity in providing educational assistance for students will live eternally through the lives of the scholarship recipients and the countless numbers of patients each student touches,” Nursing Dean Dr. Teri Murray (Nurs ’79, Grad Nurs ’93, Grad Ed ’97) said. The nursing school plans to honor Hoppe and her husband, Dr. Robert Hoppe (Med ’51), at its 90th anniversary celebration this fall. Dois

    Universitas: the magazine of Saint Louis University

    No full text
    Spring 2007 issue of Universitas: the magazine of Saint Louis UniversityRemembering Father Mac PAGE 8 DR. ROB E RT BELSHE DR. MAR K BULLER PA UL C Z YS Z DR. G REG EVANS DR. DEE ANNA GL ASER DR. JOEL GOL DS TEIN DR. JERRY KAT Z DR. JOHN MORL E Y DR. K EN WA RREN DR. TER RI L . WEAVER VACCINE DEVELOPMENT VIRAL-BORNE DISEASES AIR CRASH INVESTIGATION BIOTERRORISM COSMETIC DERMATOLOGY VICE PRESIDENCY ENTREPRENEURSHIP GERIATRIC MEDICINE U.S. POLITICS POSTTRAUMATIC STRESS DISORDER Hearing Voices PAGE 16 Trophy Life PAGE 20 Volume 33, Issue 2 E d i t o r Laura Geiser (A&S ’90, Grad ’92) C o n t r i b u t o r s Clayton Berry Marie Dilg (SW ’94) Jeff Fowler Jeanette Grider Joe Muehlenkamp (A&S, Cook ’89, Grad ’98) Rachel Otto Andrea Roewe Nick Sargent Nancy Solomon “ O n C a m p u s ” n e w s s t o r i e s University Communications Medical Center Media Relations Billiken Media Relations De s i g n Art Direction: Matthew Krob Universitas is published by Saint Louis University. Opin-ions expressed in Universitas are those of the individual authors and not necessarily those of the University ad-ministration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for pub-lication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 221 N. Grand, St. Louis, Mo. 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, Universitas. Postmaster: Send address changes to Universitas, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html Universitas is printed by Universal Printing Co. and mailed by Specialty Mailing. Worldwide circulation: 118,600 © 2007, Saint Louis University All rights reserved. Each spring I look forward to our com-mencement ceremony. There is just something about the sound of the organ filling Scottrade Center and the sight of hun-dreds of graduates having their pictures taken in their caps and gowns smiling ear-to-ear flanked by a parent on each side with even bigger smiles on their faces. I love the banners, the academic attire and the ritual of it all. It is an exciting time for professors, students and parents alike, and the thrill culminates for me when I get to roar at the end of the ceremony: “I declare you sons and daughters of Saint Louis University forever!” Many students find it difficult to see past my role as priest and president, but at heart, I am also an educator. I spent 12 years as a mem-ber of the faculty at Loyola University Chicago teaching and six years as a dean at Loyola be-fore I became president of SLU. I value my time as a professor because what I learned from my students in the classroom has influenced the educa-tion- focused decisions I have made as president here. So, it is a joy for me to see so many students excited about what they have achieved during their time at SLU and to witness their enthusiasm for the future. Every year, I wonder how the gradu-ates in the audience will go on to achieve great things and how the University will play a role in those successes. With nearly 108,000 SLU alumni living around the world, there are many stories of SLU sons and daughters making the University proud. But in February, I was blessed to spend time with one of those sons. He has not only gone on to achieve great success, he saw fit to share it with SLU. I am sure some of you will find familiar the name that adorns the Chaifetz Arena (read more on page 2), our long-awaited, on-campus arena, because its namesake may have been a former classmate. Dr. Richard A. Chaifetz, who made a 12 million naming rights gift to the arena project, graduated from Saint Louis University in 1975 with a bachelor’s degree in psychology. During the past 30 years, Chaifetz founded Chicago-based ComPsych Corp. and oversaw its growth into the world’s largest provider of employee-assistance programs. It’s truly a blessing that Rich is sharing the success he achieved after graduating from SLU. But as an educator, I was more touched to hear Rich tell the story that inspired him to give back to his alma mater. During a press conference announcing his do-nation, Rich told the media in attendance about the day he visited the office of former University President Paul Reinert, S.J. As Rich told those in attendance, he was faced with the possibility of having to leave SLU because he could not pay his tuition. When Rich reached the president’s office, he was obviously nervous. But Father Reinert took the time to meet with him and listened to his story. Rich punctuated his plea to stay at SLU by promising that if Father Reinert allowed him to remain in school, he would not only pay SLU the tuition he owed but give back even more when he established him-self. Clearly, he’s made good on that promise. Rich truly understands the benefits he received by attending Saint Louis University, not only be-cause of the investment Father Reinert made in him, but the kindness that all those who support the University showed him. Donations, whether small or large, make it possible for future gen-erations to share in the educational experience you received at Saint Louis University. As we push forward to have SLU recognized as the finest Catholic university in the nation, we will continue to need the assistance and leader-ship of sons and daughters like Rich — and like you. By making the University even better, you not only give current students the opportunities you received, you strengthen the value of your degree as SLU’s stature and reputation improve across the country. No matter how long ago it was that you took those special pictures with your parents or felt the excitement of graduation rush over you as “Pomp and Circumstance” began to play, I hope you will always remember you are sons and daughters of Saint Louis University, forever. — Lawrence Biondi, S.J. P r e s i den t ’ s Me s s age U N I V E R S I T A S w w w . s l u . e d u U N I V E R S I T A S S P R I N G 2 0 0 7 F EAT U RES DE PARTMENTS 2 On Campus Arena named for Chaifetz Service hours grow Med dean to retire New endowed chairs Rec Center expands 6 Billiken News Three fall NCAA Tourney appearances New Hall of Fame inductees 7 Campaign Update A conversation with Tom Keefe, development vice president 24 Class Notes Catch up with classmates 28 In Memoriam Remembering those members of the SLU community who recently died 30 Alumni Events Find SLU alumni activities wherever you live 32 Perspective An alumnus shares the courage and inspiration of his college roommate 33 The Last Word Letters to the editor 8 16 Remembering Father Mac SLU’s champion of Cupples House and the arts, Maurice McNamee, S.J., died in January. By Clayton Berry and Nick Sargent Meet the Experts Insights and experiences from 10 faculty members who frequently appear in the media. 10 Photos by Jim Visser 20 Hearing VOICES An innovative program helps members of the SLU community find their calling. By Marie Dilg Trophy Life A Q&A with alumnus Mark Lamping, president of the St. Louis Cardinals. By Laura Geiser A springtime workout at the expanded Simon Recreation Center. Photo by Jim Visser U N I V E R S I T A S w w w . s l u . e d u U N I V E R S I T A S S P R I N G 2 0 0 7 6,000 Lineal feet of underground piping used in the construction 34,000 Square feet of brick being used in the project — enough to cover a regulation basketball court 7.25 times » Saint Louis University announced Feb. 28 that its new 10,600- seat multipurpose arena will be named in honor of University alumnus Dr. Richard A. Chaifetz (SHAY-fetz), who made a 12 million naming rights gift to the project. Chaifetz Arena will open in March 2008. It will be home to Billiken men’s and women’s basketball and will host other events. Chaifetz (A&S ’75) is a licensed neuropsychologist and is founder, chairman and CEO of Chicago-based ComPsych Corp., the world’s largest provider of employee-assistance programs (EAP). ComPsych is also the leading provider of fully integrated EAP, behavioral health, work-life, wellness, crisis intervention services and outsourced human resources solutions under the GuidanceResources brand. ComPsych provides services to more than 25 million individuals and 10,000 or-ganizations throughout the United States and 92 countries. Chaifetz is one of the world’s most frequently quoted experts on behavioral health, workplace issues as well as employer and employee trends. “It is an honor for Saint Louis University to have Dr. Richard Chaifetz’s name on our arena, which will mean so much to the Uni-versity and the entire St. Louis community,” said University President Lawrence Biondi, S.J. “Not only is Dr. Chaifetz respected around the world for the success of ComPsych Corp., but we take special pride because he is an extremely successful alumnus who cares deeply about his alma mater and future generations of SLU students.” “I am proud to have the University name this arena in my honor,” Chaifetz said. “My education at Saint Louis University has had a tre-mendous impact upon my life, both personally and in business. As an avid sports fan, I have fond memories of the many sporting events I attended while an undergraduate at SLU. Having the arena in my name is especially meaningful.” Chaifetz is a native of New York, and in 1971 he turned down an appointment to the U.S. Military Academy at West Point to attend SLU on the advice of his high school dean and mentor. He credits for-mer University President Paul Reinert, S.J., with helping him remain at SLU when financial issues threatened his ability to stay in school. “Father Reinert told me he believed in me and allowed me to stay at SLU at a time in my life when I didn’t have the financial resources to pay for my tuition,” Chaifetz said. “I promised him not only would I pay my tuition, but that I would pay back the University in an even bigger way in the future. Now, this is an opportunity for me to give back to the University for all the support and guidance I received as an undergraduate here. It is my hope that Chaifetz Arena will en-hance the on-campus experience for every future Saint Louis Univer-sity student, as well as the city of St. Louis.” Chaifetz has been named to the Who’s Who list of Crain’s Chi-cago Business for three consecutive years — 2004, 2005 and 2006. He serves on the board of directors of several corporations, as well as nonprofit organizations. Chaifetz received his Psy.D. from the Il-linois School of Professional Psychology. He is married and has two children. — Jeff Fowler At the construction site of the new Chaifetz Arena SLU lauded in recent rankings Two publications, St. Louis Maga-zine and the St. Louis Business Journal, have recognized Saint Louis University as one of the area’s best places to work. St. Louis Magazine named the region’s “45 companies that know how to keep their employees happy.” SLU was highlighted for its award-winning retirement plan. In addition, for the second straight year, the St. Louis Regional Chamber and Growth Association named SLU to its list of “Greater St. Louis Top 50 Businesses Shaping Our Future.” The 50 companies recognized in 2006 were selected for their contributions to the St. Louis region and future impact on the business community. more than 300 Philosophy professors worldwide name saint louis University programs among the best Top philosophers from around the world gave high marks to philosophy pro-grams at Saint Louis University. The Philosophical Gourmet Report ranked SLU’s medieval philosophy program the best in the United States and rated the philosophy of religion program behind only those at Notre Dame and Oxford universities. SLU also earned a special mention in epistemology, the philosophy of knowledge. More than 300 philosophy professors worldwide completed online surveys about philosophy departments in the United States, Canada, the United Kingdom, Australia and New Zealand. SLU welcomes noted speakers The former prime minister of Israel, Ehud Barak, visited Saint Louis University earlier this year and dis-cussed “Blueprint for Global Relations: A Macro Analysis of How National Politics, International Events, Terror and the Econ-omy All Influence National and Interna-tional Relations.” Prime minister of Israel from 1999 to 2001, Barak led the country out of prolonged recession and into an eco-nomic boom. In February, famed filmmaker Spike Lee was the keynote speak-er for SLU’s celebra-tion of Black History Month. He is known for such films as Do the Right Thing and When the Levees Broke, a documentary focus-ing on the plight of Americans stranded in New Orleans after Hurricane Katrina. Lee delivered a presentation titled “The Media’s Affect on Black America.” The spring 1982 edition of Universitas featured the cover story “Portrait of the Class Clown” describing a student’s effort to become a professional clown. He said running away to the circus is not as easy as it sounds. Don Ganz (A&S ’78, Grad Cook ’83) shared his experience at Barnum & Bailey Clown College and how that opportunity made him more marketable. After his three-month adventure at clown college, Ganz returned to SLU to complete his MBA. The magazine also included an article, remembering Joseph “Buck” Davis, S.J. The story reflected his many contributions to the University in his years of service. The founder of what is now the John Cook School of Business, Davis used his self-taught business skills to recruit nearly the entire staff for the school. Businessman Martin Shaughnessy, a close friend of Davis’, donated 750,000 for construction of a home for the school, which was named Davis-Shaughnessy Hall for their efforts. Also, in this issue, University President Thomas Fitzgerald, S.J., discussed changes in national legislation for financial aid. Fitzgerald focused on SLU’s dedication and commitment to its students. He said the administration was working on ways for students to afford a SLU education, in light of the financial aid cuts proposed by President Ronald Reagan. Lee Sign of the Times Sister Mary Terese Donze (A&S ’44), a resident of DeMattias Hall, shared one of her many inventions — a gadget that rewound adding machine paper so it could be used four times instead of just once. – from the story titled “Nun Has 2nd Career as Inventor/ Author” Quotable UTAS “Thomas Aquinas long ago pointed out that learning takes place only if the learner does something. One cannot pour knowledge into the head or heart of a student as one pours wine into a glass.” — Dr. Francis L. Gross Jr. (A&S ’55, Grad ’56, ’64), an author speaking about his book Passages in Teaching: Predictable Crises in the Teaching of Adolescents and Young Adults. Gross taught in the theology department from 1966 to 1969. Arena named for alumnus Richard Chaifetz Make a gift and follow the construction of Chaifetz Arena at arena.slu.edu. Photos by Kevin Lowder above LEFT: Chaifetz (far right) and his family look over a 1975 SLU yearbook with Mary Bruemmer (second from left), former dean of women and University volunteer. Center: The Chaifetz family (from left), Jessica, Ross, Richard and Jill with a rendering of Chaifetz Arena. right: Biondi (left) presents Chaifetz with a Billiken basketball jersey. Biondi (left) and Chaifetz at the news conference announcing the new name. U N I V E R S I T A S w w w . s l u . e d u U N I V E R S I T A S S P R I N G 2 0 0 7 Photo by Jim Visser News Briefs Drs. Paul J. Shore, Todd Swanstrom and Stephen Paul Wernet received Fulbright Scholar grants this school year. Shore, a professor of educa-tional studies, is at the Collegium Budapest in Hungary. Wernet, a pro-fessor of social work, is at Ostrava University in the Czech Republic. And Swanstrom, a professor of public policy studies, is at the University of Amsterdam in the Netherlands. Dr. Charlotte Royeen, dean of the Doisy College of Health Sciences, won the National Jesuit Book Award for 2006. Royeen is co-editor of Educat-ing for Moral Action: A Sourcebook for Health and Rehabilitation Ethics. Darius U. Dunn is the general manager of the new Chaifetz Arena. Dunn previously served as associate director of the Stephen O’Connell Center at the University of Florida. Dr. Brian D. Till, chairman of the mar-keting department at the John Cook School of Business, was appointed to the Clarence and Helen Steber En-dowed Professorship in Marketing. The endowed professorship was created in 1971 to recognize a scholar in the field of marketing for teaching, scholarly work and work with the business com-munity. At the construction site of the new Chaifetz Arena 430,000 Hours of work that will be spent on the 18-month project 75,000 Cubic yards of dirt that will be moved during construction — about 375,000 full wheelbarrow loads 191 Drilled piers in the foundation, each approximately 30 feet tall campus enthusiastically embraces RecREATION Center expansion The University recently completed a 40,000-square-foot expansion of the Simon Rec-reation Center, paid for by students who voted to assess themselves a fee to fund the project. The new space includes more than 150 new pieces of fitness equipment, a juice bar and lounge, additional locker rooms, several multipurpose rooms, wellness suite, traversing wall and gaming area. Students so enthusiastically embraced the expansion that less than a month after it opened, the Rec Center expanded its hours to meet demand. Additional improvements are planned for this school year. The second phase of the project includes renovations to the main level and the second floor. The lobby, locker rooms, elevated track and special event rooms will be updated. An elevator also will be installed. DEAN OF THE SCHOOL OF MEDICINE ANNOUNCES HER RETIREMENT Dr. Patricia L. Monteleone (Med ’61, Pub Hlth ’91, Grad Cook ’91) one of the first women appointed to lead a U.S. medical school when she was named the 11th dean of Saint Louis Uni-versity School of Medicine in 1994, announced her intention to retire in March. With 13 years of service, she is the longest continuously serving woman dean in the history of U.S. medical schools. Monteleone, a pediatrician with an expertise in medical genetics, has presided over the school during a time of rapid change in American medicine. She has overseen a restructuring of the school’s medical cur-riculum; an expansion in the amount of research funding at the school from both governmental and private industry sources; and the creation of the University Medical Group (SLUCare), the clinical practice of the faculty at SLU School of Medicine. Monteleone will continue to serve as dean until a new dean is identified. Endowed chairs honor donors, slu scholars Thanks to generous donations, SLU added two endowed chairs during the last year. The James B. and Joan C. Peter Endowed Chair in Biochemistry and Molecular Biol-ogy was made possible by a donation of 2 million from Dr. James and Joan Peter. The Hubert Mäder Endowed Chair in Health Care Ethics was made possible through a $1.5 million donation from the Geschwister Mader Foundation in Zurich, Switzerland. Dr. James B. Peter (Med ’58) has had a distinguished career in academic medicine and business. He is founder and former chief executive officer of Specialty Labo-ratories, a leading hospital-focused clinical reference laboratory. He and his wife, Joan, generously supported research and educa-tion at SLU for many years. Dr. William S. Sly (Med ’57) is the inaugural chair holder. Huber Mäder, a surgeon and philanthro-pist, created his foundation to demonstrate his lifelong passion for the ethical practice of medicine. Dr. James M. DuBois is the inaugural chair holder. Annual service hours soar to nearly 780,000, survey says Members of the Saint Louis University community certainly know how to give back. In 2006, SLU students, faculty and staff contributed 779,776 hours of commu-nity service and outreach, according to the report, “Beyond the Classroom.” That’s more than in 2005 (753,806) and up significantly from five years ago, when the reported number of service hours was approximately 490,000. SLU’s academic courses and programs provide great opportunities for service. According to the new report, SLU students spent more than 80,000 hours helping the community through class and program-sponsored activities. virtual tour of italian church possible via new technology Using technology typically associ-ated with video games, two SLU theologians created an interac-tive, 3-D tour of one of Europe’s most im-portant churches. Theology professors Drs. Jay Ham-mond (A&S ’93, Grad ’94, ’98) and James Ginther spent more than a year building the virtual version of Italy’s landmark Ba-silica of Saint Francis of Assisi. Their 3-D model allows virtual tour-goers to walk nearly everywhere in the upper basil-ica and fly close to the church’s famed paint-ings and stained-glass windows. Most virtual tours of historic buildings rely on 360-degree panoramas and offer limited interactivity. Other virtual tour projects have been equally advanced, but the SLU professors’ tour is one of the first able to run on a PC. Ignatian retiree group looking for new volunteers The Ignatian Volunteer Corps is searching for retirees to help with the good work its chapters are doing across the county. The IVC is an organization that combines service to the poor with a unique process of spiritual reflection. Established in 1995 by Jesuit priests Jim Conroy, S.J., and Charlie Costello, S.J., the program is for retired women and men, age 50 and older. To learn more about the IVC or to sign u

    Universitas: the magazine of Saint Louis University

    No full text
    Winter 2020 issue of Universitas: the magazine of Saint Louis University.10 facts about SLU-Madrid Page 14 RECORD-SETTING CLASS Page 20 NEW CAREER CENTER Page 24 ST. LOUIS JESUITS’ CONCERT Page 26 FACULTY EXPERT ON VICE PRESIDENCY Page 30 WINTER 2020 | 1 VOLUME 46, ISSUE 1 EDITOR Laura Geiser (A&S ’90, Grad ’92) ASSOCIATE EDITOR Amy Garland (A&S ’97) ART DIRECTOR Matt Krob CONTRIBUTORS Jessica Ciccone Marie Dilg (Grad SW ’94) ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER SLU-Madrid students in Plaza Mayor in the heart of Madrid Photo by Fernando Béjar Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 1 N. Grand Blvd., St. Louis, MO 63103. We accept email at [email protected]. Postmaster: Send address changes to Universitas, Saint Louis University, 1 N. Grand Blvd., St. Louis, MO 63103. Website: slu.edu/universitas Universitas is printed by Breese Printing and Publishing Worldwide circulation: 123,557 © 2020, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. New and returning students gather at the first 9 p.m. Mass of the school year in St. Francis Xavier College Church. PHOTO BY STEVE DOLAN F E ATU R E S D E PARTME NTS 14 ¿Sabías? Ten facts about SLU-Madrid that might surprise you. — By Laura Geiser 20 Top Class The freshman class is the largest in SLU’s history. — By Marie Dilg 24 Beyond Career Fairs SLU’s Career Services focuses on preparing students for life after SLU. — By Marie Dilg 26 Coming Home The St. Louis Jesuits music group says farewell with a sold-out concert. — By Amy Garland 30 Vice Presidential VIP Law professor Joel K. Goldstein is the nation’s top VP expert. — By Jessica Ciccone 2 On Campus Women’s soccer A-10 championship /// Record fundraising year /// Nursing school’s new name /// Midtown development update /// Rankings /// Opus Prize 34 Class Notes 35 Alumni Spotlight Angela Lewis (A&S ’04, Grad A&S ’07) 36 How I Got Here Jim Dean (CSB ’88) 40 Letters to the Editor 41 In Memoriam 44 By the Numbers 45 The Last Look That is certainly what our campus in Spain aims to achieve — and accom-plishes with great success. From signage to statutes, SLU-Madrid succeeds at carrying out our branding. But much more than that, it lives our mission. This campus shares our vision for building a better world with more Jesuit-educated graduates. To do so on the global stage is a testament to the power of a SLU education. The stories I hear from our students, both when I visit SLU-Madrid and those who come back to St. Louis after spending time studying abroad, never cease to amaze me. Their stories and experi-ences remind me why I was called to higher education. As you will see in this issue, our students absorb culture through their time with señoras, or host families, who help broaden their perspective of Spanish culture. (Read more on page 16.) Learning does not stop when our students leave class — and in this increas-ingly connected world, it is more important than ever to lead them to become informed global citizens. The excitement we feel at SLU crosses international waters, and I’m thrilled this issue brings you a flavor of the pride we feel for our Madrid and St. Louis campuses. From regional development to record-breaking enrollment and fundraising, we certainly look forward to sharing our good news. The start of our third century and SLU-Madrid’s 52nd year brought a record-setting year for us at Saint Louis University. Our freshman class in St. Louis broke all enrollment records with 1,900 students, surpassing our previous largest class by 200 students. (Turn to page 22 to learn more.) SLU-Madrid continues to draw hundreds of students from dozens of countries who learn and grow together. And thanks to our generous donors, we once again raised a record amount in gifts for scholarships, academics, research and other ini-tiatives. We are well on our way to our 500milliongoalinourcampaign,knownasAcceleratingExcellence:TheCampaignforSaintLouisUniversity.(Seethestoryonpage10.)Whilewecertainlycelebratetheseachievements,wewillneverrestonthem.Thatsthejoyandthechallengeofacademiaalwaysplanningandadaptingfortheeverchangingworldinwhichweoperate.Themanywaysinwhichwemeetthoseneedsisbroad.Forexample,regionaldevelopmentandthephysicalchangesacrosscampus.AswelooktoourUniversitysfuture,wecontinuetofocusonopportunitiesthatwillstrengthentheUniversityforgenerationstocome.YouwillreadmoreinthisissueaboutafewexamplesoftheburgeoningdevelopmentintheMidtownSt.Louisarea.Theseincludeprojectsonandoffcampus.MomentumandexcitementcontinuetobuildforournewInterdisciplinaryScienceandEngineeringBuilding,andwearethrilledthatprogresscontinuesonthenew,500 million goal in our campaign, known as Accelerating Excellence: The Campaign for Saint Louis University. (See the story on page 10.) While we certainly celebrate these achievements, we will never rest on them. That’s the joy and the challenge of academia — always plan-ning and adapting for the ever-changing world in which we operate. The many ways in which we meet those needs is broad. For exam-ple, regional development and the physical changes across campus. As we look to our University’s future, we continue to focus on opportunities that will strengthen the University for generations to come. You will read more in this issue about a few examples of the bur-geoning development in the Midtown St. Louis area. These include projects on and off campus. Momentum and excitement continue to build for our new Interdisciplinary Science and Engineering Building, and we are thrilled that progress continues on the new, 550 million SSM Health Saint Louis University Hospital and Ambulatory Care Center. All will open this fall. SLU is also proud to be involved in developments that lead the resurgence taking place in the city’s central core, such as the redevel-opment of homes in the Gate District West neighborhood near the hospital, and the forthcoming City Foundry. (Read more on page 13.) As we share in the story about Gate District West, we are grate-ful to our St. Louis community neighbors for sharing our vision for and commitment to growing stronger together. In closing, I ask that you remember how these stories and the many initiatives behind them help fulfill our noble mission. I also ask that you share our exciting news with those you know who are young — or young at heart — who are seeking higher edu-cation. Tell them about SLU and your experience. Our world always benefits from more truth-seekers and servant leaders who are Jesuit educated. May God bless you and Saint Louis University. Dr. Fred P. Pestello President I cannot tell you what it’s like to step off of a plane after an eight-hour flight to Europe, only to walk onto a campus that feels just like home. Or perhaps I don’t have to tell many of you — those of you who have studied at or visited SLU-Madrid, or our international students in St. Louis. PRESIDENT’S MESSAGE PHOTO BY FERNANDO BÉJAR Pestello talks with students outside of San Ignacio Hall at SLU-Madrid. 2 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 3 ON CAMPUS Women’s Soccer Wins A-10 Again The Billikens women’s soccer team defeated George Washington 3-1 in the Atlantic 10 Conference Championship title game in November, securing its second straight A-10 Championship crown. Senior Courtney Reimer was named the most outstanding player of the championship. Senior Emma Farley, sophomore Hannah Friedrich, senior Alli Klug and graduate student Mary Niehaus joined her on the All-Championship team. Over the season, SLU extended its school-record unbeaten streak to 16 games. Already the winningest class in SLU women’s soccer history, the Billiken seniors registered their 64th victory. The team lost to Notre Dame in the first round of the NCAA Championship. Reimer Celebrating with the A-10 trophy Reimer (center) hugs Annabelle Copeland (left) and Farley. Farley The team celebrates at Robert R. Hermann Stadium on campus. PHOTOS BY BILL BARRETT 4 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 5 ON CAMPUS University Offers New Academic Programs, Begins Comprehensive Review Process Saint Louis University began offering many new academic programs in the fall, including: UNDERGRADUATE Bachelor of Arts in Leadership and Organizational Behavior Bachelor of Science in Health Care Ethics Minor in Dance GRADUATE Master of Science in Biostatistics and Health Analytics Doctorate in Education Policy and Equity GRADUATE CERTIFICATES American Studies Cybersecurity Strategic Intelligence Women’s and Gender Studies The University also started a formal review of its academic programs. In spring 2019, the provost established the Academic Portfolio Review Committee, tasked with analyzing and making recommendations to the provost about the size and academic scope of the University’s portfolio of offerings. This process will eventually become a regular assessment tool for all graduate and undergraduate programs. Led by faculty, the committee has representatives from the student body and administration. Dr. Mark Knuepfer, a professor in the School of Medicine, serves as the committee chair. Signature Beam: Students, faculty and staff signed their names and good wishes on the beam that would complete the topping-out of SLU's new Interdisciplinary Science and Engineering Building. Saint Louis University leaders, St. Louis Mayor Lyda Krewson, trustees, students, faculty and staff members marked the topping-out of the University’s new 50millionISEBuildingonDec.6.Thebuildingwillopenintimeforclassesthisfall.PHOTOBYAMELIAFLOODSLUNamesNursingSchooltoHonorTrudyBuschValentineInAugust,SaintLouisUniversityannouncedthatUniversitytrusteeTrudyBuschValentine(VSN80)madeagiftof50 million ISE Building on Dec. 6. The building will open in time for classes this fall. PHOTO BY AMELIA FLOOD SLU Names Nursing School to Honor Trudy Busch Valentine In August, Saint Louis University announced that University trustee Trudy Busch Valentine (VSN ’80) made a gift of 4 million in support of the School of Nursing and Accelerating Excellence: The Campaign for Saint Louis University. In recognition of Valentine’s history of philan-thropic support of SLU totaling nearly 7million,theUniversityrenameditsnursingschooltheTrudyBuschValentineSchoolofNursingandhostedadedicationduringHomecomingandFamilyWeekend2019.ValentinesgiftwasmadeinhonorofformerdeansDr.TeriMurray(VSN79,GradVSN93,GradEd97)andthelateDr.JoanHrubetz(VSN60,GradEd70,75)fortheirlegacyofleadershipofthenursingschool.Thegiftwillsupportfacultydevelopmentaswellascontinuedacademicexcellenceamongtheschoolsfacultyinteaching,research,scholarshipandleadership.ValentinehasbeenamemberoftheSaintLouisUniversityWomensCouncilsince1990.ShejoinedtheSchoolofNursingExecutiveAdvisoryboardin2000,assumingthechairpersonrolefrom2006to2015.ShewaselectedtoSLUsboardoftrusteesin2017.ValentineandherfamilyhavebeensupportersofSLUsnursingschoolforyears.Hermother,GertrudeBuholzerBusch,establishedanundergraduatescholarshipandtheJoanHrubetzEndowedChair.In2012,ValentineandherdaughterChristinaValentineCammon(VSN12)establishedtheTrudyandChristinaBuschValentineEndowedLectureSeries.Nursinghasmademerespectpeoplefromallwalksoflife,andithasopenedmyheart,mindandlifetothewellbeingofothers,Valentinesaid.ImsoproudtobepartofaprofessionthatcaressodeeplyaboutpeopleandcanmakesuchapositiveimpactonthelivesofothersaprofessionthatlivesSLUsJesuitmissiontoseekahigherpurposeforthegreatergood.IamsogratefultotheSaintLouisUniversitySchoolofNursingandveryhappytohonorDeanTeriMurray,adearfriendandmentor,forhermanyyearsofserviceandmagnificentleadership.Anactiveconservationistandphilanthropist,ValentinealsohasworkedasavolunteernurseattheSalvationArmyResidenceforChildren,MercyHospitalandtheVisitingNurseAssociationHospiceprogram.ValentinePHOTOBYSTEVEDOLANNOTEWORTHYGRANTSGERIATRICCAREINMISSOURI7 million, the University renamed its nursing school the Trudy Busch Valentine School of Nursing and hosted a dedication during Homecoming and Family Weekend 2019. Valentine’s gift was made in honor of former deans Dr. Teri Murray (VSN ’79, Grad VSN ’93, Grad Ed ’97) and the late Dr. Joan Hrubetz (VSN ’60, Grad Ed ’70, ’75) for their legacy of leadership of the nursing school. The gift will support faculty development as well as continued academic excellence among the school’s faculty in teaching, research, scholarship and leadership. Valentine has been a member of the Saint Louis University Women’s Council since 1990. She joined the School of Nursing Executive Advisory board in 2000, assuming the chairperson role from 2006 to 2015. She was elected to SLU’s board of trustees in 2017. Valentine and her family have been supporters of SLU’s nursing school for years. Her mother, Gertrude Buholzer Busch, established an undergraduate schol-arship and the Joan Hrubetz Endowed Chair. In 2012, Valentine and her daughter Christina Valentine Cammon (VSN ’12) established the Trudy and Christina Busch Valentine Endowed Lecture Series. “Nursing has made me respect people from all walks of life, and it has opened my heart, mind and life to the well-being of others,” Valentine said. “I’m so proud to be part of a profession that cares so deeply about people and can make such a positive impact on the lives of others — a profession that lives SLU’s Jesuit mission to seek a higher purpose for the greater good. I am so grateful to the Saint Louis University School of Nursing and very happy to honor Dean Teri Murray, a dear friend and mentor, for her many years of service and magnificent leadership.” An active conservationist and philanthropist, Valentine also has worked as a volunteer nurse at the Salvation Army Residence for Children, Mercy Hospital and the Visiting Nurse Association Hospice program. Valentine PHOTO BY STEVE DOLAN NOTEWORTHY GRANTS GERIATRIC CARE IN MISSOURI 3.75 million Supported by a five-year grant from the U.S. Department of Health and Human Services, Dr. John Morley, professor of internal medicine, and Dr. Marla Berg-Weger, executive director of SLU’s Geriatric Education Center and professor of social work, will partner with multiple educational, patient care and service organizations in educating, studying and caring for older adults. COMMUNICATION WITH PARENTS OF SICK CHILDREN 3.26millionDr.VernaHendricksFerguson,theIreneRiddleEndowedProfessorofNursingatSLU,isaprincipalinvestigatorforthisfirstofitskindstudy.Thegoalofthefiveyearstudyistoseeifearlypalliativeandendoflifecarediscussionsatthetimeofachildscancerdiagnosiswillimprovethequalityoflifeforparentsandtheirchildren.NONADDICTIVEPAINKILLEROPTIONS3.26 million Dr. Verna Hendricks-Ferguson, the Irene Riddle Endowed Professor of Nursing at SLU, is a principal investigator for this first-of-its-kind study. The goal of the five-year study is to see if early palliative and end-of-life care discussions at the time of a child’s cancer diagnosis will improve the quality of life for parents and their children. NON-ADDICTIVE PAINKILLER OPTIONS 2.1 million Addressing the need for better pain medications, Dr. Daniela Salvemini and her colleagues at the Henry and Amelia Nasrallah Center for Neuroscience at SLU will investigate a promising pain-signaling pathway in the hopes of opening up a new avenue for pain medication research. CELLULAR CHANGES WITH HEART DISEASE, DIABETES 1.8 million Chemistry professor Dr. Jim Edwards (A&S ’99, Grad A&S ’01) received this National Institutes of Health grant to understand cellular changes that could lead to better therapies for diabetes and heart disease. Dr. Chris Arnatt, assistant professor of chemistry at SLU, is also a principal investigator. OBESITY, CANCER IMMUNOTHERAPY 1.7 million Dr. Ryan Teague, associate professor of molecular microbiology and immunology, will study how obesity influences outcomes for cancer patients being treated with immunotherapy. ANTI-DIARRHEAL DRUG 1.65millionAssociateprofessorofchemistryDr.MarvinMeyerswillusethisNationalInstitutesofHealthgranttofocusonintelligentdrugdesignfindingnewdrugsforinfectiousdiseasesthatkillmillionsandaredevastatingforthepoor.Dr.DaveGriggs,associateprofessorofmolecularmicrobiologyandimmunology,isanotherprincipalinvestigator.SLUStartupRaises1.65 million Associate professor of chemistry Dr. Marvin Meyers will use this National Institutes of Health grant to focus on intelligent drug design — finding new drugs for infectious diseases that kill millions and are devastating for the poor. Dr. Dave Griggs, associate professor of molecular microbiology and immunology, is another principal investigator. SLU Startup Raises 30 Million in Bid to Better Manage Pain In one of the biggest investments in research com-mercialization in Saint Louis University’s history, BioIntervene, a biopharmaceutical company founded in 2014 by SLU pharmacologist Dr. Daniela Salvemini has raised 30millioninseriesAfundingfromMPMCapital.TheinvestmentwillpropelSalveminisdiscoveriesforwardandsetthestagetobeginPhaseIclinicaltrialsforanewnonaddictivepainkillerlaterthisyear.Salvemini,whoisprofessorofpharmacologyandphysiologyanddirectoroftheHenryandAmeliaNasrallahCenterforNeuroscienceatSLU,pioneeredresearchonatreatmentforneuropathicpainthatcouldprovidethefirstalternativetoineffectivesteroidsandaddictiveopioids,amarketprojectedtoreach30 million in series A funding from MPM Capital. The investment will propel Salvemini’s discov-eries forward and set the stage to begin Phase I clinical trials for a new non-addictive painkiller later this year. Salvemini, who is professor of pharmacology and phys-iology and director of the Henry and Amelia Nasrallah Center for Neuroscience at SLU, pioneered research on a treatment for neuropathic pain that could provide the first alternative to ineffective steroids and addictive opi-oids, a market projected to reach 8.3 billion by 2024. Neuropathic pain affects between 15 and 20 million people in the United States. Exceedingly difficult to treat, this type of pain can occur after injuries to the nervous system due to trauma, disease or exposure to neurotox-ins, including after chemotherapy. There is a need for new medications that do not cause side effects and addic-tion the way narcotic pain killers do. “Having the opportunity to translate one’s discover-ies from the bench to the bedside is a dream come true,” Salvemini said. “I am hopeful that our efforts will lead to the alleviation of suffering while helping end the opi-oid crisis.” Salvemini discovered that alterations in signaling within the body contribute to the development of chronic pain states and that compounds that target a key recep-tor can “turn off” pain signals, providing relief from chronic pain of various types. This discovery, she noted, provided the starting point of her collaboration with Dr. Kenneth Jacobson, chief of the molecular recognition section, in the laboratory of bioorganic chemistry at the National Institutes of Health. Salvemini SUBMITTED PHOTO 6 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 7 ON CAMPUS SLU Research Institute Grants Second Round of Funding The Saint Louis University Research Institute awarded its second round of funding last summer: More than 740,000wasgivento13facultymembersthroughtheResearchGrowthFund.Morethan70proposalshadbeensubmitted.LaunchedinSeptember2018throughagiftfromDr.JeanneandRexSinquefield(CSB67)thelargestgiftinUniversityhistorytheSLUResearchInstitutefurthersSLUsgoalofbecomingtheworldsleadingJesuitresearchuniversity.ThefirstroundofgrantswasannouncedinJanuary2019,withatotalof740,000 was given to 13 faculty members through the Research Growth Fund. More than 70 proposals had been submitted. Launched in September 2018 through a gift from Dr. Jeanne and Rex Sinquefield (CSB ’67) — the largest gift in University history — the SLU Research Institute furthers SLU’s goal of becoming the world’s leading Jesuit research university. The first round of grants was announced in January 2019, with a total of 1.8 million going to 15 faculty members. Among the 13 faculty who received grants in this second round are: Miriam Cherry, professor and co-director of the William C. Wefel Center for Employment Law, who will study methods of online justice such as amateur sleuths gathering online to collect clues in cold cases, workers sharing information online about abusive labor practices and people using the Internet to mount harassment campaigns. Dr. Terra Edwards, assistant professor of anthropology, who will finish a book manuscript, Going Tactile: Life at the Limits of Language. Her research focuses on the protactile movement, which advances the claim that hearing and vision are not necessary for things like greeting people or joining or leaving a conversation. Dr. David Ford (A&S ’80), professor of biochemistry and molecular biology and director of the Center for Cardiovascular Research, who will use new technology to investigate endothelial and epithelial barrier dysfunction. This technology will be used in the planning for a SLU Sepsis Center and the SLU Institute for Drug and Biotherapeutic Innovation. Jesuits Reckon with the Legacy of Slavery In late August, Jesuits of the USA Central and Southern (UCS) Province began contacting individuals believed to be descen-dants of people held in slavery by 19th century Jesuits, including at Saint Louis University. This is the latest work of the Slavery, History, Memory and Reconciliation Project, which started in 2016 as a joint initiative of the UCS Province and the University. The goal is to find a path to reconciliation by illuminating the lives of the people who were enslaved and connecting with their descendants. Historians have long known that when Jesuits established mis-sions in St. Louis, they relied on the labor of enslaved people to help those missions survive. To reveal the stories of courage and resil-ience among those who were enslaved and to trace their families forward, researchers have combed through thousands of docu-ments, including financial ledgers, Church records and personal journals. Dr. Jonathan Smith, SLU’s vice president for diversity and com-munity engagement, is leading the project for the University. To undertake a conversation about SLU’s next steps, Smith plans to assemble a working group that will include students, faculty, staff, alumni, trustees and descendants. To learn more about the project and to read the stories about the people who were enslaved, visit shmr.jesuits.org. SLU Launches Geospatial Institute Anew Geospatial Institute at Saint Louis University will support research, training and innovation in the rapidly growing fields of geospatial science and technology. Also known as GeoSLU, the institute brings together faculty and students from various disciplines to use geospatial research tools to solve challenges and to enhance graduate and undergraduate education. The institute’s primary areas of research will include artificial intelligence, machine learning and informatics. In launching the Geospatial Institute, SLU seeks to strengthen collaborations with other universities, including the University of Missouri System schools, Washington University in St. Louis and Harris-Stowe State University, as well as innovation partners in the region, including Cortex and T-Rex. GeoSLU also builds upon SLU’s existing relationship with the National Geospatial-Intelligence Agency (NGA). In January 2019, the University signed a partnership agreement with the NGA, and the organizations partnered on the GeoResolution conference last April. Dr. Vasit Sagan, associate professor of earth and atmospheric sciences, is the institute’s faculty director. Robert Cardillo, former director of the NGA, advises the institute as part of his work as a distinguished geospatial fellow at SLU. For more information, visit slu.edu/geoslu. Nancy McNeir Ring Award Presented for Excellence in Teaching Dr. Katie Kelting, assistant professor of mar-keting in the Richard A. Chaifetz School of Business, was selected as the recipient of SLU’s 2019 Nancy McNeir Ring Award for excellence in teach-ing. Lauded by students for her emphasis on teaching them the value of ethics in the business world, Kelting joined the SLU faculty in July 2016 and is director of the business school’s Behavioral Research Lab. On a national level, she is a Women in the Marketing Academy Fellow, among her many fellowships. She addressed graduates during December’s midyear commencement at Chaifetz Arena. Kelting PHOTO BY STEVE LONG PHOTO BY STEVE DOLAN Special Guest Star: The Stanley Cup makes a stop on campus during Homecoming and Family Weekend 2019, giving fans of the 2019 NHL champion St. Louis Blues hockey team the opportunity to make lasting memories. SLU, Urban League Honor MLK’s Legacy At their annual memorial tribute honoring civil rights leader the Rev. Dr. Martin Luther King Jr. on Jan. 16, Saint Louis University and the Urban League of Metropolitan St. Louis honored those carrying forward King’s legacy of activism and advocacy for racial equity and justice across the St. Louis region. The keynote speaker, noted journalist and author Roland Martin, told the crowd in SLU’s Busch Student Center that “leaders step up when it’s time to lead.” He chal-lenged those attending the tribute to recall King not as a mascot, but for his radical commitment to social justice a

    Universitas: the magazine of Saint Louis University

    No full text
    Summer 2001 issue of Universitas: the magazine of Saint Louis UniversityT H E M AG A Z I N E O F S A I N T L O U I S U N I V E R S I T Y S U M M E R 2 0 0 1 By Lawrence Biondi, SJ Saint Louis University President Arecent article by David Brooks in Atlantic Monthly called into question the character of col-lege students today. Brooks blames go-getter parents and educational institutions for leaving today’s college-age generation on their own when it comes to character and virtue. “We fly our children around the world so that they can experience different cultures,” Brooks writes. “We spend huge amounts of money on safety equipment and sports coaching. We ser-monize about the evils of drunk driving. We expend enormous energy guiding and regulating their lives. But when it comes to character and virtue, the most mysterious area of all, suddenly the laissez-faire ethic rules: You’re on your own, Jack and Jill; go figure out what is true and just for yourselves.” I couldn’t disagree more. That’s certainly not our approach at Saint Louis University or at any of our sister Jesuit colleges and universities. At SLU we take great pride in the education that we provide our students. We take equal pride in helping them become responsible, caring members of society. Our mission — to edu-cate the whole person — clearly states that intellectual and character development go hand-in-hand. Our students, faculty and staff connect with the St. Louis community and the world community, exploring and enriching these “classrooms without walls.” Each day, through outreach programs and research efforts, the SLU family demonstrates how knowledge touches lives. Brooks says that we assume that if adults try to offer moral instruction, it will backfire because our children will reject our sermonizing (though they don’t seem to reject any other part of our guidance and instruction). “We assume that such questions have no correct answer that can be taught,” he writes. “Or maybe the simple truth is that adult institutions no longer try to talk about character and virtue because they simply wouldn’t know what to say.” At Saint Louis University we haven’t forgotten what to say about character and virtue because we have never stopped saying it. Yes, we educate more than 11,000 students in a wide variety of disciplines. But no matter what the major or degree, there is one common thread to our learning environment. All of our stu-dents are instilled with a call to act for justice and a conviction to value the dignity of every human person. In every issue of UNIVERSITAS, we share with you stories about Saint Louis University’s academic progress, research activities and community outreach. In this issue, however, we’re focusing on our strides to foster character both inside and outside of the classroom — to introduce our students to a life of service. We’re proud to be recognized as a character-building college by The Templeton Guide: Colleges That Encourage Character Development, but we’re even more pleased that Saint Louis University students, faculty and staff volunteered more than 430,000 service hours to area organizations this past year. In all, more than 6,000 members of the University community participate in service outreach programs. At Saint Louis University, we do not separate intellectual and character development. Combining these makes the educated person sensitive to greater possibilities. Intellect and char-acter, joined together, empower our students to achieve change on behalf of a more just society. On the following pages you’ll find several articles looking at the topic of character develop-ment from various angles. One story explains the many facets and benefits of our Center for Leadership and Community Service. Another describes an innovative theology course that com-bines classroom study and community service. Still another story examines the impact a unique ethics program has had on our faculty development. And the last feature article profiles three student-athletes who are building character by balancing academics, athletics and service. We take seriously the Ignatian ideal of “forming women and men for others.” I hope you’ll enjoy reading how much. UNIVERSITAS Volume 27, No. 3 Editor Laura Geiser (A&S ’90, Grad ’92) Contributors Chris Waldvogel Marie Dilg (Soc Ser ’94) Glen Sparks Intern Alison Williams Photo Credits Bill Barrett, 20 Curt Dennison, 2, 5 Steve Dolan, 3 Kevin Lowder, inside cover, 7, 8-9, 11-13, 20-21 Kristen Peterson, 30 Dave Preston, 20, 21 James Visser, cover Chris Waldvogel, 2, 4 Design AKA Design Inc. Art Direction: Richie Murphy Design: Stacy Lanier UNIVERSITAS is published quarterly by Saint Louis University. Opinions expressed in UNIVERSITAS are those of the individual authors and not neces-sarily those of the University adminis-tration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publica-tion should indicate that fact. The editor reserves the right to edit all items. Please address all mail to UNIVERSITAS, DuBourg Hall 39, 221 N. Grand, St. Louis, MO 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, UNIVERSITAS. Postmaster: Send address changes to UNIVERSITAS, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/alumni/universitas/ UNIVERSITAS is printed by Universal Printing Co. and mailed by Accurate Business Mailers Inc. Worldwide circulation: 103,000 © 2001, Saint Louis University. All rights reserved. On the Cover: Building char-acter at Saint Louis University. IIN MEMORIIAM AALLUUMMNNII nnootteess 2 22 32 28 30 summer 2001 C O N T E N T S 6 Outreach SLU’s Center for Leadership and Community Service helps students help others. 10 Reflection A unique theology class teaches lessons in and out of the classroom. 14 Ethics An innovative program places ethics at the academic forefront. 18 Balance Three of SLU’s student-athletes prove why they’re winners. 2 School renamed to honor Doisys The School of Allied Health Professions was renamed the Edward and Margaret Doisy School of Allied Health Professions in a blessing and dedication ceremony on April 17. The late Dr. Edward A. Doisy, former chairman of the biochemistry department, received the 1943 Nobel Prize in Medicine for isolating Vitamin K and determining its constitution and synthesis. Doisy’s practice of donating the majority of the income derived from commercial application of his research find-ings to Saint Louis University Arts and Sciences dean appointed Dr. Joe Weixlmann has been named dean of the College of Arts and Sciences. Most recently, Weixlmann was the dean of the College of Arts and Sciences at Indiana State University. He succeeds Dr. Shirley Dowdy, who has retired. SLU’s College of Arts and Sciences boasts 15 depart-ments and 12 centers and pro-grams. The college is home to nearly 2,500 undergraduate students, more than one-third of the University’s total under-graduate population. More than 250 full-time faculty teach in the college. Weixlmann had been dean at ISU since 1994. SLU welcomes new vice president Edward O’Brien, SJ (Grad ’54, ’57, ’62), is the new vice president for mission and ministry for the 2001-2002 academic year. He succeeds A. James Blumeyer, SJ (A&S ’57, Pub Ser ’65, Grad ’58, ’68), who has retired and will now work in an admissions spirituality program at Rockhurst College in Kansas City, Mo. O’Brien is minister of the SLU Jesuit community at Jesuit Hall, a position he’s held since 1995. He will con-tinue to serve in this capacity. As vice president, O’Brien will supervise the campus ministry and pastoral care departments and facilitate programs that focus on the mission of the University. O’Brien also will Trustees approve new directions The board of trustees OK’d the University’s strategic directions at a May 5 meeting. Officials sought feedback from the University community on the directions, which will help determine the identity of the University. The directions establish a concrete plan of action from 2001 to 2006 to advance the vision and mission of the University. The four foundations of the strategic directions include: • Expanding research integrat-ed with teaching, learning and service. • Advancing community with diversity. • Fostering technology dedi-cated to student formation and the generation of knowledge. • Promoting continuous institutional learning and innovation. GOOD MOVE: The Childgarden building, 3840 Lindell Blvd., is being renovated to create a centralized academic ser-vices center for students. The move will allow academic advising, career services, the student educational services cen-ter and pre-professional health studies to relocate into one building, which will be ready this August. SLU purchased the building from the St. Louis Association for Retarded Citizens, which ran a day care center there. provide counsel to the SLU administration to ensure the Jesuit mission in education is being realized. Before becom-ing the minister of the Jesuit community at SLU, O’Brien served as the pastor of St. Matthew the Apostle Parish in St. Louis. O’Brien makes him the School of Medicine’s largest private donor. His wife, Margaret Doisy (A&S ’60), was honored and assisted in cutting the rib-bon at the ceremony. Those cutting the ribbon for the Doisy School of Allied Health Professions included (from left) SLU trustee Robin Smith; Dr. Joan Hrubetz, interim dean of the school; Margaret Doisy; and University President Lawrence Biondi, SJ. NEWS BRIEFS By The Numbers 11 Images available as “virtual postcards” on the SLU Web site (www.slu.edu/postcards). The images include many photos previ-ously featured in the pages of UNIVERSITAS. 60 Percent of the 1,539 recent SLU graduates who are female. 84 International students who graduated this year. They repre-sented countries such as Spain, Korea, India, Taiwan and China. 14,404 Number of SLU alumni celebrating reunions this year. The total includes all alumni who gradu-ated in years ending in a one or a six. The Council for Advancement and Support of Education (CASE) has selected University President Lawrence Biondi, SJ, to receive the Chief Executive Leadership Award for CASE District VI. CASE is the largest nonprofit edu-cation association in terms of insti-tutional membership and serves some 28,000 advancement profes-sionals on the staffs of member institutions. … Denis E. Daly, SJ (Grad ’58, ’60, ’66), has joined the development office as assistant vice president for development, focus-ing on raising major gifts from alumni and friends of the University. Most recently, he was assistant vice president for mission and ministry at the Health Sciences Center. … Dr. Michael Burks has joined the University in the newly created position of director of Web development, overseeing all aspects of the University’s inter-nal and external Internet sites. … Dr. Ik-Whan G. Kwon (Pub Hlth ’90), professor of decision sci-ences and director of the John Cook School of Business’ Consortium for Supply Chain Management, has received a Fulbright Grant for the 2001-2002 academic year. He will lecture and conduct research at the Korea Development Institute School of Public Policy and Management and at Yonsei University in Seoul, Korea. … Dr. Avis Meyer (Grad ’76), professor of communication and adviser to The University News since 1974, is this year’s winner of the Mary A. Bruemmer Award. Established in 1980, the award is given annually to the faculty, staff member of administrator who has done the most to improve student life and enhance the SLU experi-ence. It is named for Bruemmer (A&S ’42, Grad ’60), the former dean of student affairs and a University volunteer. … St. Louis Mayor Francis Slay (Law ’80) dis-cussed his plans for the economic development of St. Louis during two appearances at SLU in May. Program ranked 2nd in the nation The School of Law once again has been recognized for one of the top health law programs in the nation. The U.S. News & World Report 2002 edition of “America’s Best Graduate Schools” ranked SLU’s health law pro-gram No. 2 in the United States. Established in 1982, the Center for Health Law Studies is the source of sever-al law publications, including the leading health law case- Updates planned for Busch Center The Saint Louis University board of trustees has approved a proposal for the renovation and expansion of the 118,000-square-foot Busch Memorial Center into a mod-ern student and alumni center. SLU students indicated their support for the student center project by passing a Student Government Association reso-lution in April to assess a stu-dent fee to help fund the Log On for SLU News To learn about the most up-to-date news and happenings at Saint Louis University, you now can visit the SLU Newslink site on the World Wide Web (www.slu.edu/newspage.html). You also can subscribe to a daily e-mail message that highlights the top SLU news of the day, previews upcom-ing events and notifies the University community of announcements and services. CLASS OF 2001: More than 1,500 students, including those pictured at left, participated in SLU’s commencement ceremony on Saturday, May 19, at Savvis Center. Dr. Arnold L. Mitchem (second from left, above), president of the Council for Opportunity in Education, was the speaker. Others receiving hon-orary degrees were (from left) Margaret Farley, the Gilbert Stark Professor of Christian Ethics at Yale University; Richard Baron, president and CEO of McCormack Baron & Associates; Raymond J. Kalinowski, former vice chairman and corporate trea-surer at A.G. Edwards; and Elizabeth Kalinowski, an active volunteer with charitable and civic organi-zations. book and treatise and the Journal of Health Law, pub-lished jointly with the American Health Lawyers Association. In addition, the physician assistant program at the Edward and Margaret Doisy School of Allied Health Professions was ranked No. 10 in the coun-try. The physician assistant education program consis-tently has had a 100 percent passage rate on the national certification exam taken by all PA graduates from around the nation. (next page) 4 Two garner SLU teaching award Two professors have joined a distinguished list of teachers at Saint Louis University. Dr. Dan Finucane (Grad ’83, ’93), assistant pro-fessor of theological studies, and Joel K. Goldstein, profes-sor of law, have been named as recipients of the 2001 Event celebrates internationalism Experts from around the globe offered some unique perspectives on Jesuit educa-tion both worldwide and at Saint Louis University during a recent panel held in con-junction with Atlas Week, a celebration of the many inter-national aspects of the University. The symposium “Education and Service in the Jesuit Tradition: Responses to Culture and Context,” fea-tured panelists Gonzalo Arroyo, SJ, vice president and professor of economic ethics for Universidad Alberto Hurtado in Santiago, Chile; Mauricio Gaborit, SJ (A&S ’71, Grad ’73), academic vice president for Universidad Centroamericana, in San Salvador, El Salvador; David Wessels, SJ (A&S ’68), profes-sor of political science for Sophia University in Tokyo, Japan; and Dr. Paul Shore, associate professor of educa-tional studies at SLU. John Padberg, SJ (A&S ’49, Grad ’51, ’54, ’59), director of the Institute for Jesuit Sources and rector of the SLU Jesuit com-munity, moderated the event. Symposium panelists agreed that Jesuit institutions around the world must continue to immerse themselves in the politics, concerns and culture of the particular region in which they serve. Atlas Week included the symposium, classroom activi- Public Health to have new address Renovations are under way at the former Compton Heights/Incarnate Word Hospital, purchased earlier this year from Tenet Healthcare Corp. Scheduled for completion this August, the renovated building, now called Salus Center, will house the SLU School of Public Health, administrative offices and the print shop. Plans for the building also include a satellite site for the Simon Recreation Center. Some of administrative offices are relocating from Fitzgerald Hall, 3500 Lindell Blvd., freeing up Fitzgerald Hall for additional technology-equipped classrooms. Group honors its Women of Year The women’s commission has honored five mem-bers of the University com-munity as the 2001 Women GRAND ACQUISITION: The University has acquired the Grand Forest apartment complex, located east of Marchetti Towers on Laclede Avenue. The com-plex features 132 two-bedroom apartment units and park-ing for approximately 170 vehicles. ties and roundtable discus-sions. The week ended with the Billiken World Fair, a fes-tival of the food, music and dance of the many cultures represented at SLU. renovation. Busch Memorial Center, 20 N. Grand Blvd., was built in 1967. Although it has undergone some renova-tion, students have been seek-ing a larger, more comfortable place to relax and socialize for several years, said SLU vice president of student develop-ment Kathy Humphrey. “The expanded center will be large enough to host major events and provide a central focal point for campus extracurricu-lar activities,” she said. Students carrying the flags of nations represented at SLU march through the quad during the Billiken World Fair on April 6. of the Year. The commission honors an administrator, fac-ulty member, professional staff member, support staff member and student. Given since 1978, the award recog-nizes the outstanding contri-butions of women to the University. The award-win-ners for 2001 are: Dr. Susan C. Tebb, dean of the School of Social Service; Dr. Mary E. Case (Med ’69), co-direc-tor of forensic pathology and professor of pathology; Teri R. McCarthy (A&S ’71), director of the employee assistance and employee health programs; Mary Beth Erickson, administrative assis-tant to the vice president for mission and ministry; and Erin Nealon, a senior in the College of Arts and Sciences. 10 Soccer coach joins dental center He’s won two world championships as coach of the Brazilian national indoor soccer team. In fact, through a career spanning 150 games, he’s only seen two losses. But in dental circles, Dr. Eustaquio Araujo is better known as a world-class ortho-dontist. It’s this reputation that led him to SLU as director of the graduate program in orthodontics at the Center for Advanced Dental Education. Araujo found it difficult to leave his native Brazil, but it was his dream to direct an orthodontic program in the United States. “The Saint Louis University Center for Advanced Dental Education is considered the No. 1 facility in the world for graduate den-tal education,” he said. “It is a distinct privilege to be here.” He initiated the graduate orthodontic training program at Catholic University of Minas Gerais in Belo Horizonte, Brazil, where he most recently served as dean of the School of Dentistry. The summer 1991 issue of UNIVERSITAS announced the establishment of the School of Public Health, which was (and still is) Missouri’s only school of public health. The issue also included information about plans to create the Museum of Contemporary Religious Art in Fusz Hall. MOCRA, which fosters dialogue among different religious tradi-tions, opened the next year. In other UNIVERSITAS news: The 1991 commencement speaker was ABC News’ Nightline anchor Ted Koppel, and author Fr. Andrew Greeley also received an honorary degree. … The Souers Stroke Institute was established at the Health Sciences Center. … The now-regular feature “By the Numbers” debuted. The magazine also included a photo essay of the newly refur-bished St. Francis Xavier College Church, which had been rededi-cated on May 12, 1991, following a year-long renovation. In addition to the many architectural updates, the renovation included many less apparent improvements, such as central heating and air condition-ing and new lighting and sound systems. Quotable UTAS: “If we are to make important decisions, we must know what is going on — good and bad. … Let American media be a thorn in the side and a pain in the butt to our most revered leaders and institutions. It is, when we consider the alterna-tives, by far the safest course.” — Ted Koppel, in his commencement address. Sign of the times: It was report-ed that SLU groundskeepers plant-ed 11,995 flowers in 1991. They planted 29,800 flowers this year — not counting 36,000 spring bulbs. chosen from hundreds of schools to be included on a list of 50 universities emerg-ing as the top schools in the nation under the Ivy League. The story focuses on schools that were once considered “safety” choices for students but have risen from those ranks in recent years because of higher academic standards. SLU was picked because of its growing national reputation and was mentioned frequently as a “hot school” by guidance coun-selors across the nation. A panel of admissions counselors commented that SLU has invested signifi-cantly in scholarships and infra-structure. A Saint Louis University freshman also was interviewed and said he was accepted to 47 out of 50 schools but chose to attend SLU. BURNING BRIGHT: Organ donor families remem-ber their loved ones at the 17th annual Candlelight March held April 19 at Saint Louis University. The event featured a march to the University’s clock tower, where families lit candles in honor of the donors and received a “Gift of Life” rose as a tribute. Nancy McNeir Ring Award. Presented annually since 1966, the award recognizes the outstanding faculty mem-ber of the year as chosen by members of Alpha Sigma Nu, the Jesuit honor society. The awa

    Universitas: the magazine of Saint Louis University

    No full text
    Winter 2005 issue of Universitas: the magazine of Saint Louis UniversityVolume 31, Issue 1 EDITOR Laura Geiser (A&S ’90, Grad ’92) CONTRIBUTORS Marie Dilg (Soc Ser ’94) Jeff Fowler Doug McIlhagga Patrick O’Malley DESIGN Art Direction: Matthew Krob UNIVERSITAS is published by Saint Louis University. Opinions expressed in UNIVERSITAS are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not in­tended for publication should indicate that fact. The edi­tor reserves the right to edit all items. Address all mail to UNIVERSITAS, DuBourg Hall 39, 221 N. Grand, St. Louis, Mo. 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, UNIVERSITAS. Postmaster: Send address changes to UNIVERSITAS, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html UNIVERSITAS is printed by Universal Printing Co. and mailed by Accurate Business Mailers Inc. Worldwide circulation: 113,474 © 2005, Saint Louis University All rights reserved. President’s Message LAWRENCE BIONDI, S.J. There’s nothing better than welcoming new students, cutting the ribbon on a new building or launching a new aca­demic program. As you might imagine, I’m very excited about the plans for our new Research Building, the new brick program for our Arena (see page 16) and the new Doisy College of Health Sciences (read more on page 2). And it’s great to share with you the new look of UNIVERSITAS. It’s easy to get caught up in beginnings. But a recent SLU “ending” got me thinking. You see, the end of the year marked the retire­ment of Dr. Joan Hrubetz, dean of the School of Nursing. Joan had been on the SLU faculty for nearly 30 years and was dean since 1982. When I came to SLU in 1987, she was a huge help to me as I took the reins of this great place. She has been my dear friend ever since. Comings and goings are what universities are all about, I suppose. Joan had a very long stay here, but that’s the exception. The students who walk through our archways know that they will stay here just a few years — after all, college is the first step on the journey to the rest of their lives. That’s why it’s so important that we give our students the best experience possible during their seemingly brief time here. We’ve recently an­nounced a 1.7millionacademicinitiativethatwilladdnewfulltimefaculty,increasesalariesforparttimeprofessorsandprovidemoreassistanceforgraduatestudents.Werealsoplanningtoin­vest1.7 million academic initiative that will add new full-time faculty, increase salaries for part-time professors and provide more assistance for graduate students. We’re also planning to in­vest 2 million in capital improvements, includ­ing technology. Clearly, it’s not enough to maintain the status quo. We owe our students inspiration and inno­vation. As is our tradition, we need to ensure that there are abundant opportunities for academic and spiritual enrichment. It’s not easy to remain on the cutting edge, but we must. The university cycle — students becom­ing alumni each spring, and high schoolers be­coming Billikens each fall — demands it. Those of us who get more than a “temporary” stay here know that although our students will surely leave this place one day, we pray that they will keep it in their hearts forever. LAWRENCE BIONDI, S.J. PRESIDENT From the Editor As you’ve probably noticed by now, this issue of UNIVERSITAS looks very different from the last one you received. Yes, we’ve had a design makeover, but one thing remains the same — this is still your magazine, full of news, stories and updates about your alma mater and fellow alumni. The look may have changed, but, as always, we’re still working to tell great stories, share terrific photos and give you the latest SLU scoop. And, of course, we still need to hear from you! Your class notes, letters, story ideas and submissions ensure that UNIVERSITAS reflects our entire community. So please keep in touch. Thanks for your patience as we’ve updated our look. I hope you’ll think it was worth the wait. — L.G.FEATURES 1 UNIVERSITAS WINTER 2005 DEPARTMENTS 2 On Campus Nursing and Allied Health schools merge Hrubetz retires U.S. News rankings feature SLU Students make a difference 6 Billiken News Billiken Hall of Fame names honorees Student athletes win academic award again 7 Campaign Update SLU receives the largest ever humanities gift 27% by ’07 Challenge update 27 Off the Shelf Six books by alumni authors 28 Class Notes Catch up with classmates 32 In Memoriam Remembering those members of the SLU community who recently died 34 Alumni Events Find SLU alumni activities wherever you live 36 Perspective A professor sees the tsunami aftermath 37 The Last Word Letters to the editor 8 Winning with Integrity A Q&A with Cheryl Levick, SLU’s new athletic director. By Doug McIlhagga 12 Count on it SLU is more than just numbers, but we gathered them anyway. Compiled by Laura Geiser and Patrick O’Malley 16 Paving the Way Help build the future of the SLU Arena, brick by brick. By Jeff Fowler 24 Getting a Clue Explore SLU’s innovative certificate program in forensic science. By Marie Dilg Photo by Kevin Lowder 20 No Place Like Homecoming Didn’t get back for Homecoming? Here’s the next best thing. Photos by Steve Dolan A view of the clock tower from a bridge near Samuel Cupples House.2 U NIVERSITAS www.slu.edu U.S. News recognizes SLU as a best buy again For the seventh consecutive year, U.S. News & World Report has recognized Saint Louis Univer- sity as one of the nation’s best values in higher education. In its special “America’s Best Colleges” is- sue, U.S. News ranks the University among the top 50 national, doctoral universities on the “Great Schools, Great Prices” list. SLU was in the top third of the over- all rankings of “national universities” that offer a wide range of undergraduate majors as well as master’s and doctoral degrees. The University was among the top fi ve Catholic institutions on this list. SLU’s Parks College of Engineering, Aviation and Technology earned the No. 30 spot on the list of best undergraduate engineering programs. The col- lege’s electrical and computer engineering programs were ranked 17th among the nation’s best electrical/electronic/communications engineering specialties. The John Cook School of Business was listed at No. 87 on U.S. News’ rankings of the country’s best undergraduate business programs. Univer-sity is-lege’s Two Saint Louis University schools, once part of the same school before split- ting in 1979, have rejoined with a new name: the Edward and Margaret Doisy College of Health Sciences. The SLU board of trustees recently approved this new joint venture of the School of Nursing and the Doisy School of Al- lied Health Professions. The School of Nursing will remain as a unit within the college, as will the departments of clinical laboratory science; health information management; dietetics and nutrition; nuclear medicine technology; physician assistant edu- cation; occupational science and occupational therapy; and physical therapy. University offi cials said that new and shared core courses in areas such as genetics, infor- matics, ethics, forensics and health economics could be developed to ensure that SLU stu- dents remain on the leading edge of education in all of the various health professions. “Students always are our number one prior- ity,” said Dr. Charlotte Royeen, dean of the combined school who previously had served as dean of the Doisy School of Allied Health Pro- fessions. The dean of nursing, Dr. Joan Hru- betz retired in December. The combined school has an undergraduate enrollment of 951 and postbaccalaureate pro- fessional and graduate enrollment of 569. The college is named after Dr. Edward A. Doisy and his wife, Margaret. Edward was chairman of the SLU School of Medicine biochemistry department and received the 1943 Nobel Prize in Medicine for isolating Vitamin K. Nursing dean retires Dr. Joan Hrubetz (Nurs ’60, Grad ’70, ’75), professor and dean of the School of Nursing and a much beloved edu- cator, retired in December. During her 22- year tenure as dean, Hrubetz led the School of Nursing to numerous national accolades for excellence in teaching, innovative research and graduates who are known for their clinical competence as well as their patient care. Hrubetz joined SLU in 1975 and became dean of the School of Nursing in 1982. She said she is most proud of the new programs she helped usher in, including the doctoral program in nursing and an Internet-based dis- tance learning program, and of the friendships she made with her co-workers and students. “I wish I’d been able to be more present to more people, to express my great appreciation and affection for them,” Hrubetz said. “The friends I’ve made, the opportunities I’ve had have been almost indescribable.” She said she plans to stay in touch with her colleagues and stay busy in retirement. “I’m off to do something else,” Hrubetz said. “I want to learn to be a better cook and spend time with some of my friends who re- tired earlier.” She said she also is interested in staying active in various community groups. Allied Health and Nursing form new college More than 1,000 volunteers rolled up their sleeves for the seventh annual SLU Make a Difference Day on Oct. 23. Accompanied by community members and local high school students, SLU students, faculty and staff members spent the day helping approximately 70 area organizations and projects. Make a Difference Day is a national day of service and the largest community service effort in the nation. In 2004, 3 million volunteers participated nationally. Service locations included Saint Louis University’s own Campus Kitchen (shown right), St. Matthew the Apostle Church’s community garden in north St. Louis, various sites in Forest Park for planting and clean up, and the George Washington Carver House, a community center near SLU. The University also hosted Homeward Bound at the Simon Recreation Center. This program offered area homeless people a hot meal, clothes and information. The event also featured a job fair and a law clinic. Students participate in national service day: photo by Dennis CaldwellSchmitz is interim Public Health dean Dr. Homer Schmitz is the interim dean of the Saint Louis University School of Public Health. He is a pro­fessor of health management and policy and has been a member of the SLU faculty for 27 years. Most recently, Schmitz was president and chief executive officer of Abbott Ambu­lance, from 1998 to December 2003. He was executive director of SLU’s University Medi­cal Group from 1994 through 1997. Schmitz was executive director of HealthLine Corpo­rate Health, an occupational health service that had been a subsidiary of SLU, from 1992 through 1995. Jeans too tight? 50% can blame genes According to a School of Public Health study, about 50 percent of adult-on­set weight change remains genetic. Dr. James Romeis, professor of health services research and the study’s principal investigator, published the results in a recent issue of Twin Research. He studied twins who served in the military during the Vietnam War — identi­cal (who share the same genes) and fraternal (who share half their genes) — and found that genes account for more than 50 percent of the change in Body Mass Index. What is eaten, the amount eaten and how much a person ex­ercises accounts for the other 50 percent. A total of 98 SLUCare doctors made the list of the best doctors in St. Louis and were featured in the cover story of the August issue of St. Louis Magazine. This represents more than a quarter of the doctors in the University’s physician medical practice. Jeff Fowler is SLU’s new associate vice president for University marketing and communications. He oversees media relations, marketing, Web services, publications and graphic design. Fowler joined SLU in December 2000, and many St. Louisans still recognize him from his time at KSDK-TV Channel 5, where he was a reporter and anchor for more than a decade. The St. Louis Business Journal recently named Dr. Ellen Harshman one of St. Louis’ most influential businesswomen of the year, lauding the dean of SLU’s John Cook School of Business for her commitment to the University and to education in general. Kathy Humphrey, vice president for student development, received the 2004 William B. Sweet Distinguished Service Award from the Upper Midwest Region of the Association of College and University Housing Officers. It is the association’s highest honor. Dr. John Morley, director of the division of geriatric medicine and the Dammert Professor of Gerontology, received the 2004 Joseph T. Freeman Award from the Gerontological Society of America. The annual honor is a lectureship in geriatrics and is awarded to a prominent physician in the field of aging — both in research and practice. News Briefs 3 UNIVERSITAS WINTER 2005 Outreach honored Dr. Ruth Murray, professor of nurs­ing in the Doisy College of Health Sciences, received the 2004 “In Touch with the Community Award” for her dedication to both SLU and the St. Louis community. Murray has spent 35 years at SLU. For 21 years, she also has volunteered at the St. Patrick Center, a faith-based so­cial service agency that provides opportuni­ties to the homeless and chronically men­tally ill homeless. At her suggestion, a client health clinic was established at the center in the 1990s. Prof explores global warming trends In the future, global warming might not be as severe in the central United States as in other parts of the country, accord­ing to scientists at Saint Louis University and Iowa State University. Using a detailed regional climate model, these researchers esti­mate summertime daily maximum tempera­tures will not climb as high in a Midwestern region — centered on the Missouri/Kansas border — as anywhere else in the United States. The hole stretches for hundreds of miles and includes Missouri, Iowa, Nebraska and Oklahoma. “The modeling showed that warming in the United States will be stronger in winter than sum­mer and stronger at night than during the day,” said SLU’s Dr. Zaitao Pan, an assistant professor of earth and atmospheric sciences. “But we found what looked to us like a ‘hole’ in the daytime warming in summer, which was a surprise.” After discovering the hole in climate projections for the 2040s, Pan went back to examine the observed maximum daily temperatures from 1975-2000 in the region. “We found that, in fact, this hole already has started to develop,” he said. Gateway to service: Saint Louis University’s freshmen spent one of their first days on campus doing community outreach. With help from the student group Oriflamme and resident advisers, more than 800 freshmen completed service projects around St. Louis through SLU’s first “Gateway to Service.” About 200 freshmen used blue paint to brighten the Grand Boulevard bridge (above). About 300 students gardened in Forest Park. Altogether, the newest SLU students worked at a dozen area sites. photo by Dennis Caldwell4 UNIVERSITAS www.slu.edu New CEO named for SLUCare The physician practice of Saint Louis University School of Medi­cine, SLUCare, has a new leader. Jeffrey Mossoff has joined SLU as chief executive officer of the University Medical Group follow­ing a national search. At the University of Mississippi, Mossoff was the executive vice president of the University Clinical Associates and execu­tive director of the university’s Faculty Practice Plan. At SLU, he manages a 15-department clinical practice of 350 faculty physicians who provide tertiary care services at more than 100 area locations. SLU alum Garry Wills wins Literary Award SLU alumnus Garry Wills (P&L ’57) received the 2004 Saint Louis Liter­ary Award in October. The award is given annually by the Associates of Saint Louis University Libraries to an outstanding author based on his or her body of work. Wills is a historian and critic known for his exposés on religion, history and government. He has won numerous awards including two National Book Awards, the 1998 National Medal for the Humanities and the Pulitzer Prize for Lincoln at Gettysburg. Several of his works were New York Times bestsellers. Wills is a regular contributor to the New York Re­view of Books and an adjunct professor of history at Northwestern University. As re­cipient of the award, he joins a select group of authors including Tennessee Williams, Arthur Miller, Eudora Welty, Shelby Foote and Joyce Carol Oates. The award has been given annually since 1967. Alumni leader joins SLU Dr. Stephen Petersen is SLU’s new associate vice presi­dent of alumni rela­tions. For 24 years Petersen was vice president for student affairs at Central Missouri State University in War­rensburg, Mo. He also served in top adminis­trative positions at the University of Vermont, Indiana University and Coe College. His SLU duties include promoting and fostering con­tinuing interest in SLU on behalf of alumni and other constituent groups. Researchers study West Nile product An experimental product created from the blood of Israelis is under investigation at the School of Medi­cine to treat people infected with West Nile virus who become severely ill. The product is made from the plasma of Israeli donors who have high levels of antibodies to West Nile virus because the disease has been widespread in Israel for decades. The school is among 36 sites participating in a national clinical trial, which is funded by the National Institute of Allergy and Infectious Diseases. There is no specific treatment for West Nile virus; health professionals only can offer supportive care. Make this house your second home: How would you like to find yourself in a magnificent three-story mansion with 42 rooms, 22 fireplaces and beautifully etched stained-glass windows? You can, and purchasing a lottery ticket isn’t necessary. By becoming a docent at Saint Louis University’s Samuel Cupples House, you will lead tours through a home filled with elegant furnishings and five centuries of decorative art. Your guests will view the Turshin Glass collection that chronicles the history of glass from 1800 to 1950. And you will be the guide through a home listed on the National Register of Historic Places. Time after time you will learn something new about an era and a home that stands refurbished but somehow untouched. If you’re interested in becoming a docent, call Willie Meadows at (314) 977-3575. Cupples House is open to the public from 11 a.m.-4 p.m., Tuesday through Saturday. Olympic flame on campus: The Olympic torch stopped at Saint Louis University this summer during its journey to Greece for the 2004 Olympics. Celebrated speed skater Bonnie Blair carried the flame to SLU. Above, Blair — who has won five Olympic gold medals, more than any other U.S. woman in summer or winter competition — acknowledges the crowd at SLU. The relay stopped at the University June 17 for a 15-minute break, with participants and the torch resting between Busch Student Center and Ritter Hall. SLU also had other connections to the torch; doctoral students Alberto Friedmann and Samantha Wilson carried the flame during its journey through St. Louis. Nottingham Photography Photo by Allison Babka Burney Photo by Allison Babka Burney Photo by Kevin Lowder5 UNIVERSITAS WINTER 2005 Goglia now on Parks faculty John Goglia, a member of the National Transportation Safety Board for nearly a decade, has joined the faculty of Saint Louis University. As a professor of aviation science in Parks College of Engineering, Aviation and Technology, he is creating programs that address transportation safety and disaster prevention and preparedness. Goglia also is pursuing initiatives that address safety internationally. He maintains an office in Washington, D.C., where he is widely noted as a tireless advocate for transportation safety. Goglia was appointed to the NTSB in 1995 after a long career in aviation maintenance. The first board member to hold an FAA aircraft mechanic’s certificate, Goglia played a key role in focusing international attention on the increasing significance of aircraft maintenance in aviation accidents. Freshmen claim a fluffy world record In August, Saint Louis University made a run at the Guinness World Record for the “World’s Largest Pillow Fight.” And after the feathers, or polyester fiberfill, cleared, SLU’s 1,211 participants had topped Duke University’s record of 1,074 participants set last March. The pillow punches flew during a student retreat at the YMCA Trout Lodge in Potosi, Mo. Although the University may not know for some time whether Guinness has approved its record-breaking effort, SLU enlisted the help of YMCA staff as well as students from Potosi High School to ensure they smashed the previous mark. The pillow fight was part of the “Billiken Road Trip,” a retreat to help freshmen make new friends and interact with classmates away from campus. In addition to the pillow fight, the students continued orientation studies and listened to an inspirational talk from Kathy Humphrey, vice president for student development. Years since UNIVERSITAS began running the “By the Numbers” section Issues of UNIVERSITAS that have included a “By the Numbers” section (including this one) Numbers that have appeared in all of the “By the Numbers” entries since UNIVERSITAS launched the section Sum of all the numbers ever used in “By the Numbers” (excluding this issue) Page on which you’ll find a feature story devoted to our “By the Numbers” section New VP oversees enrollment John Baworowsky is the University’s new vice president for enroll­ment and academic services. Most recently, he was vic

    Effect of experimental modulation of mood on exertional dyspnoea in chronic obstructive pulmonary disease

    No full text
    Background and Objective Dyspnoea is a debilitating symptom in individuals with chronic obstructive pulmonary disease (COPD) and a range of other chronic cardiopulmonary diseases and is often associated with anxiety and depression. The present study examined the effect of visually-induced mood shifts on exertional dyspnoea in individuals with COPD. Methods Following familiarization, 20 participants with mild to severe COPD (age 57–79 years) attended three experimental sessions on separate days, performing two 5-min treadmill exercise tests separated by a 30-min interval on each day. During each exercise test, participants viewed either a positive, negative or neutral set of images sourced from the International Affective Picture System (IAPS) and rated dyspnoea or leg fatigue (0–10). Heart rate (HR) and peripheral oxygen saturation (SpO2) were measured at 1-min intervals during each test. Mood valence ratings were obtained using Self-Assessment Manikin (SAM) scale (1–9). Results Mood valence ratings were significantly higher when viewing positive (end-exercise mean ± SEM = 7.6 ± 0.3) compared to negative IAPS images (2.4 ± 0.3, p < 0.001). Dyspnoea intensity (mean ± SEM = 5.8 ± 0.4) and dyspnoea unpleasantness (5.6 ± 0.3) when viewing negative images were significantly higher compared to positive images (4.2 ± 0.4, p = 0.004 and 3.4 ± 0.5, p = 0.003). Eighty-five percent of participants (n = 17) met the minimal clinically important difference (MCID) criteria for both dyspnoea intensity and unpleasantness. HR, SpO2 and leg fatigue did not differ significantly between conditions. Conclusion These findings indicate that the negative affective state worsens dyspnoea in COPD, thereby suggesting strategies aimed at reducing the likelihood of negative mood or improving the mood may be effective in managing morbidity associated with dyspnoea in COPD.Full Tex

    Folder 2: Miscellaneous References to Work, 1970-77

    No full text
    This folder contains twelve items that reference Walter J. Ong, S.J. in some way. Only one item has been digitized and is represented here.Items in this folder are from Sub-Series 1: Personal Bibliography. Father Ong kept this Personal Bibliography set of files (sub-series) together immediately before his Publications files. The sub-series title, “Personal Bibliography,” is somewhat misleading in that the material in these files is not really a bibliography at all. What Father Ong apparently meant by collecting these folders under the heading “Personal Bibliography” is that these items all held some importance to Father Ong, but they did not neatly fit into another series category. This notion of personal importance seems to be the common characteristic, whether the item is a publication containing a reference to his work, a brief summary or discussion of his work, a short statement he made about someone else’s publication, or a text of a talk or paper he never intended to publish.PLEASE POST volume VIII: 6 March 1971 POETRY+CFR1'ER rJOItkJlIO~Ma2tlf J4 BISHOP TUTTlE MEMORIAL BLDG. ~ ! rS p.m.&fl'ee 1210 Locust • ROOM 109 lfiss Casebolt ,President of Poetry Center, became involved with PC with the tirst Poetry Concert, 1960,which she directed. Responding to the suggestion that PC ot-ter instruction in Poetry, she has taught classes in poetry at the Library tron 1963 to the present,& has evolved a tech-nique for writing poetry spontaneously. Last year she set up classes in Creative Writing tor Children using much the same method; has trained teachers, & continues to supervise the activity. Former editor of Curled Wire Chronicle, her long poems , SONGS OF THE ECC, and THE FIRE ODES have been performed in our Poetry Concerts. PROCEDURE: Mail no more than 3 typed ori-ginal, unpublished poems,2 copies each to: Miss Kathrene Casebolt 4323 Maryland, st Congradulations to poet Howard NeMe-rov, professor of 'English at Washing· ton U, St Louis, who has been awer-ded the 1971 Fel-tlowship by the !Board of Cboncel- ) lors of Tbe Aca-demy of American Poets, ( of which PC is an affiliate). culmative This is an honor of exceeding di-mensions, crowning achievements with recogni- POETR Y CENTER SPEAKING published by St. Louis Poetry Center, lnc., a non-profit organization ~ 4323 Maryland. St. Louis. Mo. 63108 editor: K. Casebolt Poetry Center is pleased to an-nounce that the Rev Walter J.Ong SJ and Dr Anne- Marie Hamburg, both professors at Saint Louis, U, and members of the Poetry Center Board of Chancellors ,have accepted as Jud-ges for our 1971 Poetry Contests. It is a real ho-nor to have the eMinent Critic and widely published au- Fa-the..- On9 co~ti'" u€J commercial positions 2 years--following matriculation at Rockhurst College(BA). Thereafter he entered the Society of Jesus continuing his studies at Saint Louis University (MA,STL) and Harvard (PhD), and was ordained priest in 1946. Twice recipient of the Guggenhein Fel-lowship he has been visiting professor at a number of universities here and abroad,et the Universit~r of Poitiers in France, McGill University in Canada, Yale, NY University, U of California, t.oyola (Chicago', and others. His pre-sence is sought in dialogues & on out-standing panels as critic, commentator & moderator whenever he can be obtained. Father Ong was a close friend of the late Teilhard de Chardin, & an as-sociate of the noted Marshall McLuhan when the latter was a member of SLU faculty. For the Sesquicentennial of Saint Louis University in 1968 Father Ong, as editor,gathered an internation-al roster of philosophers, educators, govermnent officials and theologians who contributed essays for the symposium on man's dilemma between his brightened knowledge explosion and his darkening survival potential. In KNOViLEDGE & the FUTURE of f..~N, Father Ong writes: "Des-pite all his achievements man remains a permanent threat to himself, 'a be1ng darkly wise and rudely great.'" In the HOMAN GRAIN & The BARBARIAN WITHIN are books by Father Ong which should inter-est Center poets. A few years ago when Saint Louis University adopted the forward-looking policy of encouraging,ir not enjoining, its professors to go�� into the commun Lt y & participate with the object of draw-ing the community into the lire of the University, Father Ong took the initia-tive and suggested that some members of the English Dept (within reason) make themselves available to organizations such as Poetry Center. He has always been ready to suggest critiCS, speakers and judges wherever possible for our activitIes.He has himself acted as cri-tic at our Workshop, and through him we have become aCCluainted with Dr Montesi, poet John Knoepfle, Sister Scholastics ~fandeville, end others. This intelligent response has served to raise the stan-dards of the almost unique st Louis Po-etry Center, a community grou~ of poets & artists existing entirely outside the oampuse a.whtch yet draws upon the know-ledge & training of individuals who have achieved prominence in their own fielas. There is no better time l1.Orplace than this to discharge an obligation and ex-press thanks to Father Ong for his ser-vices, not only to Poetry Center, but to poetry in general. Dr Anne~arie Hamburg, recipient of many prizes in poetry, especially from her native France, who will also judge our poetry contests, is welLknown to readers of these pages where her ac-complishment s have been followed with interest.Publication date of her latest book of poems has not yet been announc-ed. FRANCITE, 8 new l1tero1'y magazine, of which she is the founding editor, should also appear later this year. VERSE PLAY Contest JUDGES Mr Richard Clarid~e, who has di-rected the win11ing Verse Plays in past years, is Judge of the Verse Play Con-test along with Vice-president Lockwood ~\Ti1ey, his colleague on the faculty or East Alton-Wood Hiver High School. Mr Claridge already has a career or drama and speech behind him before he became intrigued with drama while an undergrad-uate. He went on to take his l,~astersin drama at Saint Louis University. ~,:r Claridge wa s the judge for a nat ional playwritin~ contest for several years, & is at present directing an "E. Oscar Thslinger Award" winner--(1969), ADAM HAD RED HAIR by Dr Robert Duncan,to be performed in the National Drama Compe-tition, an annual Convention ror Hf.gh Schools where the competition is se-vere and of high quality. Mr Lockwood Wiley, known in tilewhole ereater st Louis area for his readings of poetry, was promoted recently to Director of' ~redia Center, Wood River, Illinois. We are fortunate to bave expertly trained talent in speech and drama to judge our Verse Play Contest--especial-ly since it was made a national compe-t it i on this year. Incidentally the Con-test name has been changed and will henceforth be called: the Mr &. Mrs John R. Conover Verse Play Award. Next year the donor, Mrs Conover, will increase the Award from 125toJ150.25playswereenteredthisyear,.andwiththenationalizingoftheBuderPrizeforIdealiSIninPoetry(donor,MrsGustavusA.Buder)therewasamarkedincreaseinthenumberofpoemssubmitted.Therewere300poems(inroundnumbers)withapproximatelyhalfarrivingfromalmosteverystateintheUnion.TheBuderPrizeof125 to J150. 25 plays were entered t hi s year, .and with the nationalizing of the Buder Prize for IdealiSIn in Poetry( donor, Mrs Gustavus A. Buder) there was a marked increase in the number of poems sub-mitted. There were 300 poems (in round numbers) with approximately half ar-riving from almost every state in the Union. The Buder Prize of 100 was an-nounced in The Writer's Digest, and the response was prompt & in volume. We had 200 inquiries for rules, alone. An un-fortunate change in Contest Chairman after the announcement Was published in The Writer's Digest, inconvenienced many who consequently received t.heIr rules too close to the deadline to g~t off the ir poems. We regret this awkwar-d mishap, but wish to assure all that it was .,just one of those things" which could not be foreseen nor remedied in time. Please acce~t our apologies. The Verse Play .\wardwinner will be announced. in t he next issue of PCS.The winners in the Poetry Contests will. be me de- public at the spring Poetry Con-cert. This year it occurs on Palm Sun-day, April 4. It begins at 3 pm,--r; vd t hout admission charge, & the public is invited. Farm &Home SaVlllgsBldg., 7801 Forsyth, Clayton For information call Treasurer Mrs Ed-wards WOodland l-70ge Al Montesi's MICROGR.WS Maryhurst Press 1970 43pp Paperback 10 X 13" folio 3 Al Montesi's MICROGRAMS 'is a first book of poems by a popular teacher of several eenerations or St Louis Univer-sity ~k1ds", (4-year U-generations. of cour-ee}, On the faculty of the English Dept for the last 14 years, Dr Montesi inau~ated the Jazz Poetry Concerts, & sponsored the school literary mag Fleur de Lis.He is almost a legend on the SLU campus. Most of the poems in IlICROGRAMS take his students as subjects. His hon-esty. his heart for them informs almost evm'y poem. Compassion is the keynote in such titles as: "Lines for J.B •• My Yearling Son ••••T•o My Students in Exile" and such lines as: "Where are you to-night my son?", Until someone pulls him down with a gun." &"I cannot make this poem." The personal nature of the poems. while immediately involving the reader. makes it difficul,.o Juage them from an objective viewpoint. ec uhe Ir durat1on-probability as well. Certainly they are complex. have considerable sophistic8- tion. and undoubted skill in writing. Though there's no feeling of the author holding out On the reader, for they do not belong to the deliberate obscurity schoo1,they do pique the curiosity for deteils perheps more than they should, if, that is, they are meant to satisfy t:1e reader. The missing integer was provided. as we discovered. when Montesi read his own book of poems. They are called "AI Montesi's MICROCRAMS" with good rea son:- On Sunday afternoon, Feb 21, the Wash-ington U students invited Professor Montesi to rend his MICROGRAMS. An at-tentive audience of about 35 stuaents & a few professors responded to Dr Mon-tesi's modest manner. He supplied per-tinent notes on the person, or persons, for e~ery poem along with what Occas-ioned each. The fireball defiance and attack of the early Montesi years were absent, or had mellowed & sweetened. An articulate voice of concern & compassion had arrived. His atature as a poet-com-municator increased as he read. Also as a teacher. Also 8S 8 person. Perhsps the book requires bio-graphical material somewhere in the back section of just the sort presented with the reading. The preface is by none other than Father Ong , the Rev Walter J. Ong, SJ, who was instrumental in bring-ing Dr Montesi to st Louis from his na-tive Memphis Tennessee. ~~ SAM LAMBERT The late Sam Lambert was a quiet man with a deef interest in poetry and philosophy. 42 years ago he had open-heart surgery. Sam wrote an article on the operation, which appeared in the pa~s of his beloved newspaper, the St Louis Post-Dispatch, where he was a re- "orter for most of his life. He wrote ;"p our first Poetry Concert. (1960), published in "Pictures". Sympathy to his wife, Frances. and twin brother Frank. ++~+++++++++++++++++++++++++++++ ~OETRY IN TRANSLATION contest Donor: M~. L~lZe konnyu Western Poetry translated into English. Prizes: 25, 15, and 10. Judges:members of the Great-Poems- in-Translation panel. Three copies of original.& translation. DEADLINE: April 1, 1971. Prize poems to be pub. in Amer.Hungarian Review; an-nouncement at June Benefit Dinner. MAIL TO: AMERICAN HUNGARIAN REVIEW 5410 Kerth Rd. St.Louis, Mo. 63128 +++++++++++++++++++++++++++++++++++++++ N&rne,..o'l Cotd:invetl Poe t Nemerov came to St Louis in 1969 as the first Professor of Creu-tive Literature at Washington Univer-sity to occupy that chair which was established by native St Louisan, the late Mis8 Fannie Hurst. He continues at Waahington U, & has purchased a house here where he resides with his wife & three children. He became a member of our Board of Chancellors in 19?0. As a little side light; at the an-nual meeting of the Chancellors at the home of Mr & Mrs Gustavus A. Buder, & being pleasant weather was held out of doors,the poet sat watching the flights of Monarch Butterflies sail Over the house and treetops. During the perfect Buder buffet-sup"er which followed we met his charming wife Margaret and had interesting conversations with each. The poet has distinguished himself by gathering a large number of awards & honors. He was Consultant in Poetry to the Library of Congress, 1963-64; and recipient. Blumenthal Prize for Poetry, Chicago. 1958; Institute of Arts & Let-ters Grant ,1961; Brandeis U Arts Award, 1968; Guggenheim Fellowship 1968-69, among others. Graduate of Harvard U,1941. he has taught at a number of colleges & univer· sities & was associate editor of FURIO-SO mag. 1946-51. Nemerov is author of 9 books of poetry, his first The Image & ~,1947. His latest (not poetry) will be out this spring, Stories,Fables & Other Diversions.A four-novel author. numerous short stories.etcetera, he has nothing but success behind him. and we safely expect,nothing but SUccess ahead. 7801 Forsyth; 3:30 pm POETRY<:ENTER POETRY CONCERT April 4, 1971; Farm &Home Savings Bldg. ~ ~.,.,_ ••r' ••.• ,., i ~ T , ,.; " ~ , .' """" •.....•..~~"" •..:.. ~ unhanded by sweet waves of copper-n1tr1cacid-t1nts a trampfish and a sundove met a rainfox in the waterhalls of helsingfors they were looking for waterscrews waternuts waterbolts a cresspartout framehald the aquaventllre which later on i bought from an astringent but delicately pale promoter --G. H. Breckwoldt arIDY fnUDln& StROOL Ten behavioral-- And one identity Behav10ral equation In a linear function IHth one independent. An aberrance Of shadowed color tones. Pie R squared relates to log log scale And Ern Halley leughs At "down under" intellectuals. My mind is captive To this trapezoidal cacophony. But secretly--- I dream Of hot coffe e, Pickled pigs feet And you! I stop at the graves and play with my fancy of those lying near in their Sunday ettire. Aloof to tha world unconcerned about time which slowly brings them one with the earth. --Louada Voellner --Allen Gray silhouette of trees against the western sky As evening drapes the slopes in purple veils. Over all she stretched Long scarves of vivid red and folded them reluctantly, at last --when night came by. Feathered seeds from giant milk-weed pod, snowbirds explode from snow insulated bush! --Mya K. Pasek --Frieda Gaston Selections made by four Workshop groups plus Arpistic MUsin" chosen by Cri-tic Dr Herry Cargas. Selection by vote may lack something in discriminetion but it was fun for all. The audience loved being involved in readine, study and selection. Dr Cargas always manages to make poetry exciting

    University News - Volume 095, Issue 002 (September 10, 2015)

    No full text
    12 pages.UVol. XCV No. 2 NEWS unewsonline.com A student voice of Saint Louis University since 1919 Thursday, September 10, 2015 TheUNews @TheUNews @TheUNews @TheUNewsSports @TheUNewsArts Connect with UNews SLU climbs rankings Page 3 The refugee crisis that has gripped Europe for nearly a year, most noticeably in the last month, is a maelstrom of multifarious languages and images. From the out-set, political interests cre-ate a rhetorical problem: are these hundreds of thousands of displaced people migrants seeking geographical change, or refugees seeking asylum from a legitimate danger? A simple Google search testi-fies to the problem: media outlets might use one instead of the other, or indeed both, in the same article, suggest-ing synonymous meanings. Syria’s ongoing civil war, begun in 2011, is the primary cause of this influx of people, which reaches well into the millions. The displaced have travelled by multiple means: those wealthy enough have flown to safety, while a ma-jority embark on the journey by train, on foot, or across the Mediterranean Sea. Maritime travel has pro-voked numerous reports of shipwrecks and drownings. The New York Times re-ported Monday that within six months, more than 2,500 people died on the journey from Libya to Italy alone. Another heavily covered in-cident was last month’s dis-covery of 71 suffocated refu-gees’ bodies in an abandoned Synthesis of a crisis: the 21st-century diaspora A year of displacement ignites international debate PERIL AT SEA : Overcrowded or capsized boats have become the defining symbol of millions of refugees. While the crisis is cast as a uniquely European problem, many say the United States should play a more significant role in aid. Michelle Peltier / Adapted from Associated Press photo By TIM WILHELM News Editor See “Crisis” on Page 3 truck in Austria. Perhaps the seminal image to come out of the migration phenom-enon is that of three-year-old Alan Kurdi’s body, dis-covered on Turkish shores on Sept. 2. He had drowned, along with others, including his mother and brother, af-ter his boat capsized in the Mediterranean. The father survived and has since bur-ied his wife and sons in their native Syria. Turkey, historically a threshold between east and west, is a popular point of entry into Europe, which reflects the current political volley of blame occurring in the international media. While Europe blames Saudi Arabia and other Middle Eastern countries for not stepping in to alleviate Syr-ians’ strife, blame also shifts between European countries based on their respective responses to the influx of people. Despite the dire nature of these realities, acts of benev-olence traverse international media: more than ten thou-sand Icelandic citizens have pledged willingness to shel-ter incoming refugees, while applauding crowds across Germany greeted arrivals in bus and train stations. Evelyn Meyer, associate professor of German at SLU, is from Linkenheim-Hoch-stetten, a town of around 12,000 in southwestern Ger-many. In the beginning of the refugee crisis, she explained, nearby Karlsruhe took in the refugees arriving in the area, but space to house them was soon exhausted. The city, By JOSHUA DEVITT Contributor Campus group launches program The Global Gateway Program (GGP) is a new pilot program here at SLU designed to, according to their website, “instill in un-dergraduate students inter-national awareness, inter-cultural competence and commitment to serving the common good.” Drawing on the requirements of five reflection papers, five aca-demic artifacts, 40 hours of service learning and a cap-stone project, the program aims at creating students with a globally inclined mindset. The Global Gate-way Program’s stated goal is to “promote deeper global awareness, provide an in-troduction to intercultural competence, and instill in students a capacity to be ac-tive global citizens.” Although the GGP is not a degree or certificate, students who successfully complete the requirements will be issued a designation on their transcripts. This creates a dynamic learn-ing outcome that fosters independent thought and research not found in other traditional academic mod-els. The power is given to the students to design their own See “GGP” on Page 3 The Saint Louis women’s soccer team (2-1) traveled to Toyota Park in Bridgeview, Ill., to play Northwestern (3-1) on Sept. 4. Northwestern’s Niki Sebo ripped a ball over senior Billiken keeper Hanna Ben-ben giving the Wildcats a 1-0 lead, which they would maintain at the end of the first 45 minutes. By LEXIE VASOS Sports Editor See “Women’s” on Page 5 BALANCE: Senior forward Livi Logan-Wood tries to save a ball against the University of Illinois-Chicago at Hermann Stadium on Aug. 28. Logan-Wood has started and played in every game this season and is currently leading the team with four goals. Ryan Quinn / The University News Women’s soccer splits series 2 September 10, 2015 NEWS Say Hello to Your New Neighbors. Say Hello to Beauty on a Budget. IKEA® St. Louis, Moving in September 30 I-64 at Vandeventer Avenue We’re moving in and bringing thoughtful design and affordability with us. Like our range of innovative and beautiful kitchens designed to t your style and your budget. Visit IKEA-USA.com/st-louis for more information. © Inter IKEA Systems B.V. 2015 IKEA-USA.com/st-louis 999SEKTION/TINGSRYDkitchenBasedona10×10kitchenSEKTIONkitchenwithTINGSRYDblackwoodeffectdoors,drawerfrontsandFO¨RVARAdrawers999* SEKTION/TINGSRYD kitchen *Based on a 10'×10' kitchen SEKTION kitchen with TINGSRYD black wood effect doors, drawer fronts and FÖRVARA drawers 999* SEKTION cabinet frames in brown wood effect melamine foil. TINGSRYD doors/drawer fronts in melamine foil. FÖRVARA drawers in powder-coated steel and melamine foil. Shown with LANSA handles in stainless steel, ATTEST knobs in nickel-plated aluminum and EKBACKEN double-sided, brown-black/light turquoise laminate countertop with brown-black edge. Requires assembly. SEKTION cabinets have a 25-year limited warranty. See IKEA store or IKEA-USA.com/warranty for details. *See IKEA store for 10'×10' layout details. September Events Tuesday, Sept. 15, 4:00 p.m. DuBourg Hall Room 409 The author Micahel Palmer will read some of his poetry as part of the English department’s Sheila Nolan Whalen Reading Series. The event is free, snacks and bever-ages will be included. Saturday & Sunday, Sept. 12-13, 12:00 p.m.-10:00 p.m. LouFest in Forest Park The two-day music festival will fea-ture artists such as The Avett Broth-ers, Ludacris, Hozier, Young the Giant, Misterwives and many more. 95foraregular2daypass95 for a regular 2-day pass 60 for a single-day pass Thursday, Sept. 10, 7:00 p.m. Xavier Ballroom of College Church The “Nuns on the Bus” tour will be holding a town hall meeting as part of their seven-state journey to meet Pope Francis in Washinton D.C. The Sisters invite the SLU community to join them in coversation about trans-forming politics and the economy. Calendar PERIWINKLE: Senior Ben Broghammer takes helping a cause to the next level with his own non-profit. Emily Higginbotham / The University News Ben Broghammer’s sto-ry is one that is familiar to many: a loved one passed away after being diagnosed with cancer. However, what he decided to do afterward is where the true distinction lies. In August of 2014, only two months after his cousin, Michon Runyon, died from stomach cancer, Brogham-mer began creating a non-profit charity that would fund cancer research. That foundation, now known as Project Periwinkle, has been up-and-running since May 2015. “When she was diag-nosed, it was extremely dif-ficult for me to deal with… I decided I wanted to do something to make a dif-ference in the world,” said Broghammer, a senior Busi-ness Administration major. Broghammer described his eldest cousin as someone that he looked up to. “She was the type of person who always smiled through things, she never let the bad stuff get to her,” said Broghammer. Even after she was diag-nosed in July 2013, Runyon kept a positive spirit. “She fought her battle with strength and courage that is rarely replicated,” said Broghammer. However, just one year later, Runyon died in July 2014. While some react to loss by donating to find a cure, Broghammer took it a step further. “I wanted to raise money and do something I had con-trol over,” said Broghammer. That control included decid- Let Us Introduce You: Ben Broghammer By EMILY HIGGINBOTHAM Associate News Editor ing where money would go. While some charities spend a certain percentage of mon-ey donated on the cost of running the organization, Project Periwinkle is differ-ent. “When I set it up, every-one who is involved with it agreed that they wouldn’t take any kind of compensa-tion for anything,” said Brog-hammer. “I want everything specifically to go toward finding a cure.” After having a vision in mind for what he wanted the foundation to be, Brogham-mer had to research what he needed to create it. “I didn’t know anything about starting a non-profit foundation, but I’m the kind of person who doesn’t take no for an answer,” said Brog-hammer. So he sought guid-ance at a law clinic that took place at Washington Univer-sity. The foundation’s case was assigned to a law stu-dent, who ensured that ev-erything, forms and all, was being conducted correctly. With all of the proper steps taken, like trademark-ing Project Periwinkle, a name symbolic of the rib-bon color for stomach can-cer awareness, Brogham-mer was able to submit a 501(c)(3), an IRS form that exempts a non-profit entity from federal taxes. “I kept it quiet within the family at first because I didn’t want to go for it and have it not work out,” said Brog-hammer. “But I decided to tell my aunt and uncle, who were Michon’s parents, and her sister the day I filed the 501(c)(3). I guess they were taken aback by it all. Speech-less is a good word.” Since the launch of Proj-ect Periwinkle, the founda-tion has struck up a part-nership with SLU Cancer Center as their first fund re-cipient. “We had four or five options that we were looking at, with SLU being one of them, but SLU’s been a part of our family for a long time. They’ve impacted us, they’ve impacted me as a person.” The relationship with SLU Cancer Center began with talks about helping them with their annual ‘Bil-liken 5K,’ and has evolved into a partnership that will be developing for the next 8-10 months. “One thing led to another, and now we’re helping them with preventative care, edu-cation awareness programs and hopefully, at one point, starting a fund that goes straight to research,” said Broghammer. Along with this partner-ship, Project Periwinkle has started fundraising and spreading their mission to create awareness about stomach cancer. “Right now to start off, the money that’s coming in is good. Our message has reached a dozen countries, our online store ships to the countries within North America,” said Broghammer. Project Periwinkle is taking donations through their website, projectperi-winkle. org, and will be sell-ing ‘awareness wristbands,’ window sticker decals and t-shirts. NEWS September 10, 2015 3 Be a Responsible Billiken STOP. CALL. REPORT. 314-977-3000 witness.slu.edu dps.slu.edu Wednesday, Sept. 2 7:48 a.m.. - FIRE ALARM; Smoke from overcooked food activated the smoke detector in the 6th floor west kitchen of Demattais Hall. The area was ventilated and the alarm reset, with students allowed to enter. No fire or damage to property. 10:18 a.m. - STEALING OVER 500:ASaintLouisUniversityGroundsDepartmentemployeereportedthatanindividualnearMorrisseyHallstoleagaspoweredbackpackblowerthathadbeenontheground,alongsideaUniversityutilitycart.Aftertakingthebackpackblower,andplacingitintothetrunkofacar,theindividualdroveaway,lastseeneastboundonLindell.St.LouisMetropolitanPoliceDepartmentrespondedandareportwasfiledbythatagency.AreviewofcamerafootageintheareawasbegunbytheDepartmentofPublicSafetyInvestigator.AGroundsDepartmentsupervisordidrespondtothescene.10:34a.m.STEALINGUNDER500: A Saint Louis University Grounds Department employee reported that an individual near Morrissey Hall stole a gas powered backpack blower that had been on the ground, alongside a University utility cart. After taking the backpack blower, and placing it into the trunk of a car, the individual drove away, last seen eastbound on Lindell. St. Louis Metropolitan Police Department responded and a report was filed by that agency. A review of camera footage in the area was begun by the Department of Public Safety Investigator. A Grounds Department supervisor did respond to the scene. 10:34 a.m. - STEALING UNDER 500: A client at the Parish Center of College Church facility reported the theft of her cellular phone that she had left unattended on a charger in the waiting area. Staff at the Parish Center were notified. 12:40 p.m. - PANIC ALARM; DPS received a “ panic alarm” from Lab Room #854. Room was checked and all was secure. Building manager was notified. Cause for alarm to be activated was unknown. 10:52 p.m. - FIRE ALARM; A broken sprinkler head in the garage of The Flats caused a fire alarm activation with an evacuation. SLFD responded and were able to fix the broken sprinkler head. Maintenance also responded. Occupants were allowed back into the building. THE SLU SCOOP All Information Provided by Department of Public Safety and Emergency Preparedness “global gateway” to ful-fill program requirements through an e-portfolio re-flecting their work. The des-ignation also doubles as an enhancement to create stu-dents who, upon graduation, will be viable and valuable in the modern workplace. One notable aspect of the GGP is that it is cross-disci-plinary. Reaching out to all fields of study, the co-curric-ular formatting of the pro-gram allows for deep inquiry outside of the classroom. It is through lectures, events, organizations and clubs that the student will be able to create their e-portfolio and learn essential skills, such as utilizing a global perspec-tive, global-level inquiry and Continued from Page 1 GGP: A dynamic ‘gateway’ to global study global engagement. “This program is a few years in the making, com-bining the talents of eight faculty members from across the academic board. We have truly created a program that specifically displays and uplifts the supplemental en-richment standards,” said Annie Rosenkranz, program manager. She added, “[the production] of academic artifacts is to coincide with courses the student is already taking.” Monica Kavanaugh, the program coordinator and a graduate student, com-mented, “SLU’s students are already globally minded, so they are an easy fit into the program’s outline.” Rosen-kranz adds, “The GGP’s mission and structure is not intended to add workload to the student. It is designed to be a centering point of global activities already in place, on campus for students…[Ap-plicants are] students who may not consciously think about these programs, but could benefit well from their outcomes.” Students have also giv-en the program positive reviews. Offering a post-undergrad view, Nena Kos-eva, an International Affairs graduate student, stated, “No doubt the U.S. is becom-ing more diverse by the min-ute. Employers are looking for adaptability in regards to global issues. I would have absolutely applied if given the opportunity.” The GGP is open to un-dergraduate students from any major who are interest-ed in developing global- and self-awareness, cultivating intercultural competence and engaging in service to the world. “We are looking for a wide variety of stu-dents,” concludes Rosen-kranz, “It doesn’t matter if you speak seven languag-es, are interested in study abroad or just want to be-come globally minded. It is the inclusivity that makes the program stand-out and worth taking note.” The program is slated for long term success. New partnerships are already in the works for support ap-plications, more community partners and fluid active ad-vancement of the program. Crisis: Syria’s war-weary leave, are left desperate said Meyer, “turned to mu-nicipalities in its county to share the responsibility of providing temporary and permanent housing for ref-ugees and asylum seekers. Within a year, Linkenheim- Hochstetten created 126 temporary housing spaces for refugees and bought a building to provide perma-nent housing for 20 asylum seekers. It is working on doubling spaces in both cat-egories during this year.” Her sister, Iris, is a kin-dergarten teacher in Linken-heim- Hochstetten. While in the U.K., she assisted in a classroom of students from r e l o c a t e d families who needed help with Eng-lish. “This brought my sister into contact not only with families who relocated to the U.K. for professional reasons, but also with r e f u g e e s ,” said Meyer. “ A s L i n k e n - heim-Hoch-stetten pre-pared for the arrival of refugees, the mayor formed a task force with volun-teers to welcome the refu-gees to our community and find ways to support them in their transition to life in Germany.” Residents con-centrated their efforts on helping the newcomers with the German language, pa-perwork, employment and getting around town. Meyer’s sister’s decision to accept refugee children into her classroom was based on her prior experience abroad. Currently, German laws on class size prevent Iris’ school from taking on additional refugee students. “Now other kindergartens in town need to step up,” said Meyer, “and I’m sure my sister will volunteer to share her experiences, the do’s and don’ts, [the] best practices with her colleagues to make this as smooth a transition for the children as possible.” When asked about Ger-mans’ wider reception to the phenomenon, she had the following to say: “Mostly, I’m observing this from a con-tinent away, and only get a few short and very regional glimpses during a visit home. I think the climate is mixed. You find the entire spectrum of positions represented, from the negative, outspo-ken xenophobic views, to the positive, openly welcoming, recognizing the humanitar-ian crisis and making an effort to in-clude the ref-ugees in our society and c ommuni - ties. The re-sponse also keeps chang-ing (both by regular citizens and politicians), judging by the events of the last few weeks.” C i t i n g an article in the Ger-man news-paper Die Zeit, Meyer e x p l a i n e d that 180,000 a p p l i c a nt s have been granted asy-lum, and that this number could rise to 800,000 by year’s end. Ger-many’s Vice Chancellor, Sig-mar Gabriel, said that the country could accept half a million refugees per year for the foreseeable future, suggesting that the refugees (many of whom are young) could contribute to the Ger-man work force. “I hope that we can sus-tain it and integrate them,” said Meyer, “but I also hope that the conflicts in their home countries will come to an end. Relocating is not easy, especially under these circumstances and the many obstacles they face in their search for a safe place to live.” Continued from Page 1 I think the climate the entire spec-trum of positions represented, from the negative, xe-nophobic views, to the positive, openly welcom-ing, recognizing the humanitarian crisis. “ “ -Evelyn Meyer, Associate Prof. of German Noteworthy relocations Housing and Resi-dence Life, formerly located in Brown Hall within the Village com-plex, has moved to the Refectory Hall in Du- Bourg 157. The space was formerly used for offices, meetings and conferences. Ryan Quinn / The University News Ryan Quinn / The University News Queen’s Daugh-ters Hall, next to Morrissey Hall, now houses a Student Visit Center. The building and its staff will serve to inform prospective students. SLU jumps in national collegiate ranking Ellen Hutti / The University News TOP 100: A SLU student takes a study break on the patio of the Samuel Cupples house. After achieving the No. 99 position in last year’s US News and World Report listing of the country’s top colleges, SLU jumped to No. 96 in this year’s report. Tied in this position with SLU are Florida State University and the University of Alabama. 4 September 10, 2015 NEWS Copyright ©2015 PuzzleJunction.com 38 Nile queen, informally 40 Fiber source 43 Nerds 44 Annoyed 45 White House aide 47 Horse opera 48 Nasty 49 Metatarsal 50 Winter forecast 51 Not theirs 52 Female saints (Abbr.) 53 ___ John 54 Org. with a mission 55 From the start 57 Unit of heat 58 Fourposter, e.g. Across 1 Pessimist’s word 5 Glance over 9 Communicate silently 13 China setting 14 Artillery burst 15 Pocket problem 16 Reese Witherspoon movie 18 Burden 19 King Kong, e.g. 20 Small songbirds 21 Idiot box 22 Film genre 23 24 Indian turnover 27 Morbid 32 Study hard 33 Brawl 34 Twenty-four hour period 35 Dead-end jobs 36 Theological free thought 38 Refer to 39 Kimono tie 40 Tree trunk 41 Butcher’s cut 42 Exfoliation 44 Summer cooler 46 Combat 47 Ricelike pasta 48 A Doll’s House playwright 51 Japanese port 53 Modern courtroom evidence 56 Ice cream holder 57 Slippery legume? 59 Door opener 60 Cornered 61 Alleviate 62 Evergreens 63 Cold war inits. 64 Make like a cartoonist Down 1 Spanish white wine 2 “Pronto!” 3 Prime-time hour 4 Mai ___ 5 More secure 6 Family 7 Rara ___ 8 Neither’s partner 9 Hand tool 10 They have their pluses and minuses 11 Bond 12 Egg container 14 Neighbor of Turkey 17 Rare bills 21 Plug 22 ___ de plume (Pl.) 23 Leeway 24 Young haddock 25 Oranjestad’s island 26 Morning worship 27 Heartache 28 Part of H.R.H. 29 Dimwit 30 Debussy contemporary 31 Howler 36 Sullen 37 The Lord of the Rings Games LAST WEEK’S SOLUTIONS Copyright ©2015 PuzzleJunction.com To solve the Sudoku puzzle, each row, column and box must contain the numbers 1 to 9. Solution Think about writing for The University News! email: [email protected] Cruising A H P I H S F L J N M M C Y B J W H L R X H G A I M Z R W A A R L R A L A Q V Q X A W E N A D R P A F B R T S L K L S Z N A T R Y I T R K C E D K G A L L E Y E I U M N A E X H I C A X R B J Q R W K I O E I N W P V B P C B O N V O Y A G E R N I N P I V Q R A T N E M N I A T R E T N E R A W S L B T W G R K H Y L G I K V B C K K E T I P N M N A E B B I R A C A R K L I T N B N M S X G H X F M R T A J W C T Z X E S D T O N K Z C J I B K R G L I X E Z S C E K I R M N O M H N R P I
    corecore