40,157 research outputs found

    Título: Despertador de cortesanos

    No full text
    El ed. Louis-Michaud trabaja ca. último tercio del s. XIX-1912O ed. Louis-Michaud traballa ca. último tercio do XIX-191

    Forma cleri secundum exemplar quod ecclesiae sanctisque patribus a Christo domino summo sacerdote monstratum est

    No full text
    A mención de ed. vai diante de "tomus tertius"Sign.: A-Q, RApostillas marxinai

    Saint Louis University Billikens vs. University of Missouri, St. Louis

    No full text
    SLU Billikens vs UMSL at Busch Field in St. Louis. John Roselein (left), Peter Collico (center), and Don Aubruchon (right) surround Ed Flemming (#2, UMSL) SLU won this game 2 to 1. (13 September 1974

    Saint Louis University Men's Tennis Team, 1967

    No full text
    Saint Louis University Men's Tennis Team (1967) First row left to right: Clyde Deffaa, Ed Yoch and Paul Weirich. Second row: Bob Costigan, Ed Frank, Jack Goethals and Coach Rod Susman. [Image scanned from "All Sports Banquet Program," 4 May 1967, page 4, courtesy of Jim Leeker

    Universitas: the magazine of Saint Louis University

    No full text
    Summer 2025 issue of Universitas: the magazine of Saint Louis University.President Pestello looks back on 11 years of leadership PAGE 10 THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y SUMMER 2025 UNIVERSITAS THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSITY Message from the First Lady Beginnings and endings are filled with anticipation and a sense of adventure. What is next is unknown and ready to be created. Eleven years ago, Fred and I drove into St. Louis ready to begin his tenure as SLU’s first lay president and my role as the first first lady. We are now approach-ing the day when we step out of our roles and begin a new chapter of our lives in this great city. As we move toward this momentous transition, it is gratifying to take stock of the accomplishments we have marked and the challenges we have faced together. As Fred notes in his interview (page 10), SLU and Midtown have grown and transformed in remarkable ways — strengthened and sus-tained by SLU’s Jesuit mission and values. I had the joy of creating the role of first lady at this historic institution, bringing my own experience as a scholar of sociology and a former department chair to the work. It was a privilege to join the SLU community as we celebrated the milestones and responded to the challenges of the last decade. In one of my favorite events during our time at SLU, we honored the University’s bicenten-nial with a moving Mass under the Gateway Arch. On numerous occasions, we were warmly welcomed to the Madrid campus, and we have cherished getting to know the people and the city that make SLU-Madrid so special. I had the opportunity to help the St. Louis Literary Award, one of the first initiatives I was invited to support, become more embedded in the life of the Saint Louis University campuses. We responded to the unprecedented chal-lenges of the COVID-19 pandemic — with me teaching, virtually and then in person, and Fred leading the University in those early days of lockdown from the third floor of our house. In 2017, we began a new tradition, joining students, faculty, staff and alumni to bless and light the tree each December at Christmas on the Quad. We also hosted an annual Christmas dinner for the Jesuits who call our campus and our city home. And at the end of every semester, Fred and I have wished students luck on their final exams with cookies, pretzels, ice cream or other study day treats. We know there are many things we will miss as we leave our daily engagement with campus, but we are looking forward to engag-ing with St. Louis and campus in new ways in the years ahead. I wish President-Elect Ed Feser and incom-ing First Lady Kathy Feser many blessings as they assume these roles, which Fred and I have loved and treasured. I thank you, Billikens, for filling the past 11 years with grace, joy and countless memorable moments. Dr. Frances G. Pestello First Lady 10 Selfie-Reflection In a candid Q&A, outgoing President Dr. Fred P. Pestello looks back on his time at SLU. — by Laura Geiser 18 Reaching Research 1 SLU’s new R1 classification affirms its place among elite U.S. research universities. — by Clayton Berry 22 Moments and Milestones Recapping the events, achievements and challenges SLU faced during the last 11 years. — by Amy Garland FEATURES DEPARTMENTS 2 ON CAMPUS Introducing Dr. Edward Feser Commencement Center for Bosnian Studies MLA honor 10 million gift Softball history 30 CLASS NOTES 33 How I Got Here: Dr. Tiffany (Brown) Anderson (Ed ’94, Grad Ed ’01) — By Amy Garland 34 Alumni Merit Awards 35 Alumni Spotlight: Andy Hahn (A&S ’97) — by Debbie Dugan 37 IN MEMORIAM 41 THE L AST LOOK VOLUME 51, ISSUE 2 EDITOR Laura Geiser {A&S ’90, Grad ’92} ASSOCIATE EDITOR Amy Garland {A&S ’97} ART DIRECTOR Matt Krob ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER SLU President Dr. Fred P. Pestello takes a selfie as confetti falls during his final commencement as president on May 17. Photo by Sarah Conroy Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address: Universitas DuBourg Hall 39 1 N. Grand Blvd. St. Louis, MO 63103 Email address: [email protected] Website: slu.edu/universitas Universitas is printed by Progress Printing Plus Worldwide circulation: 103,000 ©2025, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. President Dr. Fred P. Pestello and First Lady Dr. Fran Pestello exit SLU’s commencement ceremony for the last time on May 17. PHOTO BY SARAH CONROY SARAH CONROY 2 UNIVERSITAS / THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSITY SUMMER 2025 On campus Dr. Edward J. Feser, a Roman Catholic, Jesuit-educated leader in higher education, will become Saint Louis University’s 34th president on July 1. “Saint Louis University is a remarkable institution with an impressive history of impact, and it will be both exciting and a privilege to lead it,” Feser said. “I am thrilled at the prospect of joining the SLU community and contributing to the University’s outstanding legacy.” Feser grew up in the Pacific Northwest and attended a Catholic high school in Red Bluff, California. He earned a bachelor’s degree from the University of San Francisco, a fellow Jesuit institution, before graduate school at the University of North Carolina at Chapel Hill. He comes to SLU after eight years as provost and exec-utive vice president at Oregon State University (OSU), a land-grant institution with more than 38,000 students, a 1.8 billion budget and 480millionannuallyinexternallyfundedresearch.Dr.Fesersleadershipjourneyhasbeendefinedbyasteadfastbeliefinthepowerofeducationtotransformthelivesofindividualsandcontributetoflourishingcommunities,saidEricEngler,chairofSLUsboardoftrustees.TheboardoftrusteesvotedtoapproveFesersappointmentduringitsDecember2024meeting.Heandhiswife,KathyFeser,kickedoffSLUsspringsemesterwithavisittocampusinmidJanuary.Nearly1,000membersoftheSLUcommunityattendedeventstowelcometheminperson.Throughouttheseinteractions,KathyandIheardyourloveforSaintLouisUniversityandyourcommitmenttoitsJesuitmission,FesersaidinamessagetotheSLUcommunity.WearemorethaneverthrilledtobecomeBillikens.ADVANCINGEXCELLENCEINALLTHINGSFeserstimeatOregonStatehasbeendefinedbyinitiativesthatreshapedOSUstrajectory,including:StrategicVision:Leadingthedevelopmentandimplementationofstrategicplansfocusedonstudentsuccess,researchandinstitutionalinnovation.ResearchLeadership:Championinga480 million annually in exter-nally funded research. “Dr. Feser’s leadership journey has been defined by a steadfast belief in the power of education to transform the lives of individuals and contribute to flourishing communities,” said Eric Engler, chair of SLU’s board of trustees. The board of trustees voted to approve Feser’s appointment during its December 2024 meeting. He and his wife, Kathy Feser, kicked off SLU’s spring semes-ter with a visit to campus in mid-January. Nearly 1,000 members of the SLU community attended events to wel-come them in person. “Throughout these interactions, Kathy and I heard your love for Saint Louis University and your commit-ment to its Jesuit mission,” Feser said in a message to the SLU community. “We are — more than ever — thrilled to become Billikens.” ADVANCING EXCELLENCE IN ALL THINGS Feser’s time at Oregon State has been defined by initiatives that reshaped OSU’s trajectory, including: Strategic Vision: Leading the development and imple-mentation of strategic plans focused on student success, research and institutional innovation. Research Leadership: Championing a 213 million Collaborative Innovation Complex — now under con-struction — to foster interdisciplinary research, powered by artificial intelligence and accelerated computing, and expanding arts and humanities programs. Inclusive Excellence: Achieving record-setting diversity in student enrollment while working to diversify the faculty and embed equity and inclusion across OSU’s operations. Budgetary Innovation: Implementing a new shared responsibility budget model to advance transparency and financial stability. GUIDED BY SERVICE, COMMITTED TO COMMUNITY Throughout his career, Feser’s leadership has been rooted in the Jesuit ideals of promoting justice, nurturing the whole person and contributing to the greater good. “I am deeply grateful to Dr. Feser for his willingness to serve in such an important role. His experience as a scholar and administrator makes him uniquely qualified to lead a place as complex as SLU,” said Thomas P. Greene, S.J., the provincial superior of the Jesuits USA Central and Southern Province. “But even more, I was heartened to hear of his desire to use education to engender hope in the young, his commitment to the University being leaven for the city and his dedication to the University’s Jesuit, Catholic identity.” “The rigorous and holistic Jesuit education I received at the University of San Francisco — grounded in experiential learning in the city itself and the principle that one should lead an active life of service to oth-ers, especially the least among us — shaped my values in ways too many to count,” Feser said. A scholar of city and regional economic growth and development, Feser strongly believes that all universities must be partners in serving and improving the well-being of the communities they call home. At OSU, his community-focused efforts included: Downtown Hub: Opening the OSU Portland Center in downtown Portland, which anchors the university’s strategy in the city, including programs to support expanded pathways to OSU for students from diverse backgrounds. Community Partnerships: Growing the OSU-Cascades campus in Bend, Oregon, and collaborating with local leaders to launch the development of a campus-based innovation district to support regional economic develop-ment goals. Economic Development Leadership: Serving on boards and commissions to address economic development, workforce strategies and public policy challenges. SLU’s President-Elect at a Glance PERSONAL DETAILS Dr. Edward J. Feser 57 years old Married to Kathy Feser, a school district environmental sustainability coordinator Two adult children, Jack and Mary EDUCATION Ph.D., University of North Carolina at Chapel Hill, 1997 M.R.P., University of North Carolina at Chapel Hill, 1994 B.A., University of San Francisco, 1989 ACADEMIC LEADERSHIP HISTORY 2017-2025 Provost and Executive Vice President, Oregon State University 2015-2017 Interim Vice Chancellor for Academic Affairs and Provost, University of Illinois at Urbana-Champaign 2012-2015 Dean, College of Fine and Applied Arts, University of Illinois at Urbana-Champaign 2011-2012 Division Head, Innovation, Management and Policy, Alliance Manchester Business School, University of Manchester, United Kingdom 2007-2011 Department Head, Urban and Regional Planning, University of Illinois at Urbana- Champaign FACULTY APPOINTMENTS 2017-2025 Professor, School of Public Policy, Oregon State University 2007-2017 Professor, Department of Urban and Regional Planning, University of Illinois at Urbana-Champaign 2008-2017 Professor, Department of Agricultural and Consumer Economics, University of Illinois at Urbana-Champaign 2011-2012 Professor and Eddie Davies Chair of Entrepreneurship, Alliance Manchester Business School, University of Manchester, United Kingdom 2004-2007 Associate Professor, Department of Urban and Regional Planning, University of Illinois at Urbana-Champaign 2003 Associate Professor, Department of City and Regional Planning, University of North Carolina at Chapel Hill 1997-2002 Assistant Professor, Department of City and Regional Planning, University of North Carolina at Chapel Hill Introducing SLU’s Next President BUILDING ON PAST PROGRESS AND CHARTING A PATH FORWARD Feser’s appointment follows an extensive national search led by a committee of SLU trustees, faculty, staff, students and members of the Society of Jesus. The University’s board of trustees voted to approve his appointment during its Dec. 6 meeting. Feser will succeed Dr. Fred P. Pestello, who announced in March 2024 that he would step down at the end of June 2025. “President Pestello’s vision and outstanding leadership are evident in the success of SLU students, its excellent faculty and staff, its impressive growth in research scale and impact, the depth and quality of its partnerships and impact in St. Louis, and the achievements of Billiken student-athletes and teams,” Feser said. “I’m excited to work with the SLU community to build on Dr. Pestello’s accomplishments and advance Saint Louis University as one of the finest urban research universities in the country.” “Dr. Feser has the knowledge, experience, skill and values to serve as the next steward of Saint Louis University’s noble mission — working for and with the campus and the region to create new possibilities for a thriving, hope-filled future,” Pestello said. Look for more on Dr. Edward Feser in the next issue of Universitas. 3 SARAH CONROY 5 Class of 2025 Celebrated at Spring Commencement – photos by Sarah Conroy Accounting Prof Honored with Ring Award Neil Jansen (Grad CSB ’98), an associate professor of account-ing, won the 2024 Nancy McNeir Ring Award for Excellence in Teaching. He was recognized during the 202 4 m idyea r commencement ceremony at Chaifetz A rena in December, during which he gave the commencement address. After starting his career in the financial services industry, Jansen joined SLU in 2008. He has been the d i rec tor of the Master of Accounting program since 2010 and an associate professor since 2024, winning several faculty and teaching excellence awards along the way. The Nancy McNeir Ring Award, named for the University’s first dean of women, was established in 1966 by SLU’s chapter of Alpha Sigma Nu, the national Jesuit honor society. Jansen at the 2024 midyear commencement SARAH CONROY SARAH CONROY MED SCHOOL RECEIVES 10MILLIONSaintLouisUniversitysSchoolofMedicinehasreceivedatransformational10 MILLION Saint Louis University’s School of Medicine has received a transformational 10 million gift, one of the largest contributions in the school’s history. The gift came from a patient who wishes to remain anonymous in honor of Dr. Gerald A. Maguire (Med ’91), a psychiatrist who also pledged 100,000tosupporthisalmamater.The100,000 to support his alma mater. The 10 million gift will enhance medical education and research at SLU: 3milliontoestablishtheGeraldA.Maguire,M.D.,andJoanneS.MaguireSchoolofMedicineCuraPersonalisEndowedDeanship3 million to establish the Gerald A. Maguire, M.D., and Joanne S. Maguire School of Medicine Cura Personalis Endowed Deanship 2 million to fund the Gerald A. Maguire, M.D., and Joanne S. Maguire Endowed Chair in Neuropsychiatry Research and Education $5 million directed toward a future state-of-the-art health education center Maguire is the director of residency training in psychiatry at College Medical Center, a teaching hospital in Long Beach, California, and the faculty director of graduate medical education at Oroville Hospital, which serves his rural home community in Northern California. Co-author of Without Hesitation: Speaking the Silence and Science of Stuttering, Maguire is considered the world’s leading authority on the pharmacologic treatment of stuttering. He founded the first clinic dedicated to the scientific study and medical treatment of the condition. Pestellos Gift New Sculpture to SLU Before stepping down as Saint Louis University’s president this summer, Dr. Fred P. Pestello and First Lady Dr. Fran Pestello offered a gift to SLU. During a reception in Pius XII Memorial Library in April, the Pestellos helped unveil a new sculpture they donated to the University: “Land, Labor, Legacy” by Kyle and Kelly Phelps. The sculpture is about 20 inches tall and features four adult figures, one holding a child. The figures represent enslaved persons of African descent and members of the Osage Nation. “We know the importance of art to inspire, to provoke, to deepen understanding,” Fred Pestello said. “This work speaks to us, and it speaks to the mission of this institution.” The Pestellos met the Phelps brothers more than two decades ago, when Fred Pestello hired them to teach at the University of Dayton. Their work is in the NAACP National Headquarters as well as in the permanent col-lections of art museums in Racine, Wisconsin; Asheville, North Carolina; Canton, Ohio; and San Angelo, Texas. FROM LEFT: Edward Ibur, executive director of the St. Louis Literary Award, Dr. Cathleen Fleck, chair of the visual and performing arts department, and Pestello discuss the sculpture at its unveiling in April. SLU Joins Center for Research Libraries Last August, Saint Louis University Libraries joined the Center for Research Libraries (CRL), an interna-tional consortium of more than 200 university, college and independent research libraries. Jennifer Nutefall, dean of libraries and museums, said the CRL gives the SLU community access to the resources of the other consortium members. She sees membership in CRL as recognition of the quality of work throughout SLU’s libraries. CRL member institutions include Harvard University, Carnegie Mellon University, the University of Notre Dame and the University of California system. On campus UNIVERSITAS / THE ALUMNI MAGAZINE O 4 F SAINT LOUIS UNIVERSIT Y FROM TOP: Doisy College of Health Sciences graduates Kirti Madhu (left) and Emma Pearl Capulong embrace during commencement; Pestello (back, center) and First Lady Dr. Fran Pestello (left) take a selfie with graduates after the ceremony; Sam Deeljore, a SLU employee and new graduate of the School for Professional Studies, hugs his daughters, Agni Deeljore (left), graduating from the School of Social Work, and Jaya Deeljore, graduating from the College of Arts and Sciences, before the ceremony. SUMMER 2025 Saint Louis University’s commencement ceremony on May 17 at Chaifetz Arena featured outgoing President Dr. Fred P. Pestello as the speaker. In an address that highlighted his career from radio host to university administrator, he advised students: “Here is what matters, Billikens — wherever your path takes you: Continue to lead with love and mercy. And never vary from the quest to make ‘things the way they ought to be.’ I wish each of you as magnificent a journey as I have had.” The ceremony also included remarks from Emma Lercher, a student graduating from the College of Arts and Sciences, who encouraged the Class of 2025 to share their gifts. SLU also conferred honorary degrees upon three individuals. This year’s honorees were former trustee Patrick (CSB ’77) and Peggy Sly, who were honored for their community support, and Tom Smolich, S.J., who was recognized for his leadership of the Jesuit Refugee Service. UNIVERSITAS / THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSITY SUMMER 2025 On campus ATHLETICS Literary Award Brings Renowned Writers to Campus Pulitzer Prize-winning author Colson Whitehead received the 2025 St. Louis Literary Award from Saint Louis University on April 9. “Read, read, read to find out what kind of writer you want to be. Write, write, write to find out what kind of a writer you are,” Whitehead told audiences. His novel The Underground Railroad won the National Book Award and the Carnegie Medal for Fiction. The Nickel Boys won the Pulitzer Prize, the Kirkus Prize and the Orwell Prize for Political Fiction. Next year, Jhumpa Lahiri will come to St. Louis to accept the 2026 St. Louis Literary Award. Lahiri has written short stories, nonfiction, poetry and several novels, including The Namesake. Her Pulitzer Prize-winning collection of short stories, Interpreter of Maladies, will be the featured title for the 2026 Campus Read program. She will receive the award on April 8, 2026, and will offer a craft talk the following day; both events are open to the public. Whitehead speaks at the Sheldon Concert Hall in April after receiving the 2025 St. Louis Literary Award. Alum’s Biopic in Theaters This Fall This October, Saint Louis University alumni will get the chance to see the life of a fellow Billiken depicted on the big screen. John O’Leary (CSB ’99) came back to campus in 2023 for the filming of Soul on Fire, a major motion picture based on his 2016 bestseller On Fire: The 7 Choices to Ignite a Radically Inspired Life. The film depicts how O’Leary nearly burned to death in an accident when he was 9 years old — and how his recovery shaped his life. The movie was filmed in St. Louis, including several locations on SLU’s campus. Members of the SLU commu-nity served as extras and shadowed the director and crew. Soul on Fire is scheduled to debut in theaters across the country on Oct. 10, 2025. ENGLISH PROFESSOR WINS PRESTIGIOUS MLA PRIZE Dr. Jonathan Sawday received the James Russell Lowell Prize for the most outstanding book published in 2023, for Blanks, Print, Space, and Void in English Renaissance Literature: An Archaeology of Absence. The prize is the Modern Language Association’s top honor. Sawday, who joined SLU in 2009 and holds the Walter J. Ong, S.J., Chair in Humanities in the English department, is the 55th recipient of the award and the first from SLU to receive the honor. SLU CELEBRATES TRUMAN SCHOLAR Sam Aitchison is the sixth student in Saint Louis University history to be honored with the prestigious Truman Scholarship. Aitchison, a junior majoring in finance, leadership and human resource management, and Catholic studies, is one of 54 college students from 49 U.S. colleges and universities selected as 2025 Truman Scholars. The award is the premier graduate scholarship for aspiring public service leaders in the United States. He plans to pursue a master’s degree in secondary or higher education with the goal of teaching and, eventually, working in administration. STUDENT EARNS PRESTIGIOUS GOLDWATER SCHOLARSHIP Pascal Sikorski, a junior majoring in computer science, earned a Goldwater Scholarship, a national undergraduate award for students in STEM who intend to pursue a career in STEM research after graduation. Sikorski wants to earn his doctorate in computer science and become a professor. Last summer, he was a researcher at California Institute of Technology as a WAVE Fellow in the Advanced Mechanical Bipedal Experimental Robotics Lab. This year, he will conduct research at Oregon State University on robotic manipulation workflow alongside humans in the environmental sector. Sawday Provost Dr. Mike Lewis (left) and President Dr. Fred Pestello (right) congratu

    Universitas: the magazine of Saint Louis University

    No full text
    Fall 2003 issue of Universitas: the magazine of Saint Louis UniversityT H E M AG A Z I N E O F S A I N T L O U I S U N I V E R S I T Y F A L L 2 0 0 3 By Lawrence Biondi, S.J. Saint Louis University President I’m convinced that it must have been a SLU graduate who coined the phrase, “What a small world.” I’m sure you’ve all had a similar experience: you’re sitting in a restaurant, standing in line to check out at a grocery store or even taking in a ball game, and someone around you says something like, “Didn’t you go to SLU?” Whatever the opening line, what almost always ensues is a brief conversation between two people. They may have never met before, but it’s as if an instant connection has been made. They begin talking like old friends. Although I realize that this phenomenon frequently happens between people who share a common identity, I often come away from such experi-ences convinced that members of our SLU community transcend the superficialities of just sharing an alma mater or even a fondness for a particu-lar sports team. I truly believe our mission and our Ignatian heritage unites us on a deep-er level. The recent Homecoming festivities only reinforced my belief. As all of you know, during Homecoming, we welcome thousands of former students back to campus, putting them in contact once again with each other and with our current students, faculty and staff. There were tours of Grand Center, our own home in Midtown, as well as the new and improved Busch Student Center. There were parties, outdoor concerts, Billiken soccer, a parade and fireworks. There were golf outings, class reunions and tailgates. And serving as an appropriate, intimate ending to the weekend, there was the Golden Billiken Brunch for members of the classes up to and including the class of 1953. Alhtough all of these activities are entertaining and help to demonstrate our appreciation for members of our SLU family, perhaps the most satisfy-ing element of Homecoming is found in the personal interaction between longtime friends. For Homecoming is one of the few times during the year in which generations of Billikens come back to campus to celebrate and commemorate their shared identity. Alumni reminisce about old times while also introducing their former classmates to their personal families. We at SLU show off our campus and introduce our current family of students, faculty and staff, who share their own thoughts and feelings about the SLU experience. Alumni often share their own success stories, but more importantly, their stories about fam-ily, friends and faith. They tell me how the philosophy, ethics and theological components they once grumbled about now serve them well in their everyday lives. Conversely, we let alumni know that SLU remains committed to informing and transform-ing our current students, who, in turn, will transform society in the spirit of the Gospels. I give assurances that although the nature of higher education has changed, SLU remains true to its Jesuit, Catholic heritage — just like it has for generations, all the way back to its found-ing in 1818. Yes, we truly see the spirit of Saint Louis University revealed and refreshed during our Homecoming festivities. It gives me great joy to hear about the ways in which members of the SLU community continue to make a difference for their families, for their communities, for their professions, for their world. Though it is only one weekend during the year, there’s undoubtedly an invisible bridge that links generations of Billiken alumni together. We can be reassured that SLU continues to succeed in preparing its graduates for a lifetime of service to humankind. It’s wonderful to see that SLU is indeed “where the heart is” in so many people’s lives. UNIVERSITAS Volume 30, No. 1 Editor Laura Geiser (A&S ’90, Grad ’92) Assistant Editor Chris Waldvogel Contributors Clayton Berry Jeff Fowler Photo Credits Steve Dolan, 3, 9, 30 Joe Finlay, 4 Kevin Lowder, 10 Dave Preston, 26 John Quinn, S.J., 20 James Visser, cover, 4, 12-15 Chris Waldvogel, 2, 3, 5 New Line Cinema, 18, 20-22 Design AKA Design Inc. Art Direction: Richie Murphy Design: Stacy Lanier UNIVERSITAS is published by Saint Louis University. Opinions expressed in UNIVERSITAS are those of the indi-vidual authors and not necessarily those of the University administra-tion. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publica-tion should indicate that fact. The editor reserves the right to edit all items. Please address all mail to UNIVERSITAS, DuBourg Hall 39, 221 N. Grand, St. Louis, MO 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, UNIVERSITAS. Postmaster: Send address changes to UNIVERSITAS, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html UNIVERSITAS is printed by Universal Printing Co. and mailed by Accurate Business Mailers Inc. Worldwide circulation: 109,611 © 2003, Saint Louis University. All rights reserved. On the Cover: The new Busch Student Center courtyard. For more photos of Busch Student Center, see page 12. IIN MEMORIIAM AALLUUMMNNII nnootteess 2 24 32 28 30 FALL 2003 6 Home-Court Advantage Take a peek at the plans for Saint Louis University’s proposed arena. 10 Remembering Father Ong A look at the life of one of SLU’s most noted scholars. 12 Center of Attention The renovated and expanded Busch Student Center is drawing raves. 16 Momentum The Campaign for Saint Louis University marks its first anniversary. 18 Lore of the Rings A SLU professor is one of the world’s foremost experts on J.R.R. Tolkien. C O N T E N T S 2 SLU named a ‘Best Buy’ again Saint Louis University is the nation’s top educa-tional buy among all Jesuit institutions according to U.S. News & World Report, which again recognized Saint Louis University as one of the country’s best values in high-er education. Overall, the magazine also ranked SLU among the top four Catholic universities in the country. In the publication’s “America’s Best Colleges 2004” issue, SLU is No. 41 on the best values list among all national doctoral universi-ties. This is the sixth consecu-tive year that U.S. News has highlighted the University as a leading educational value. SLU is the top Jesuit institu-tion on the best value list and the No. 2 Catholic school, second only to the University of Notre Dame. U.S. News determines best values by measuring academic quality with the net cost of atten-dance for a student who receives an average level of financial aid. U.S. News also named Saint Louis University among the top four Catholic institutions on its ranking of best national doctoral universities, a group that includes nearly 250 schools. SLU is No. 78 on the list, with only Notre Dame, Georgetown University and Boston College ranking higher. HOMELAND SECURITY: Hundreds of people attended the first town hall meeting on homeland security featuring U.S. Homeland Security Secretary Tom Ridge Oct. 7 at Saint Louis University. An interactive event with high audience participation, the forum included (from left) Frank Sesno, host of Worldtalk and former CNN anchor; Steve Rohleder, global chief executive for government, Accenture; St. Louis Mayor Francis Slay (Law ’80); Ridge; Dr. Karen Webb, chief medical officer for Saint Louis University Hospital; and Col. Tim Daniel, director for the Missouri Office of Homeland Security. University President Lawrence Biondi, S.J., gave the opening remarks. Sword award to honor Westfall Saint Louis University will give its highest honor to the late George R. “Buzz” Westfall (A&S ’68, Law ’69). SLU will recognize the late political leader with its Sword of Ignatius Loyola during the DuBourg Society Dinner Dec. 7. Mr. Westfall died Oct. 27. He was 59. One of the region’s most influential public figures of the last 20 years, Mr. Westfall was elected St. Louis County executive in 1990 and was re-elected three times. Noted for his bipartisanship and regional focus, his accomplish-ments included the establish-ment of a shelter for battered women and children. The Sword of Ignatius Loyola is named for the founder of the Society of Jesus. Symbolic of the Ignatian vision of service, sword recipients have given themselves to humankind for the greater glory of God. Louis; Keith F. Muccino, S.J., assistant professor of internal medicine and Catholic chap-lain at Georgetown University School of Medicine; and Robert L. Niehoff, S.J., vice president for budget and plan-ning at the University of San Francisco. New trustees join SLU board Three new trustees have joined the Saint Louis University board: L.B. Eckelkamp Jr., chairman of the board and CEO of the Bank of Washington (Mo.) and chair-man and president of Cardinal Bancorp and Cardinal Bancorp II, which owns the United Bank of Union and Citizens National Bank of Greater St. SLU JOINS A10 CONFERENCE Saint Louis University is joining the Atlantic 10 Conference. The Billikens will begin intercollegiate athletic competition in the Atlantic 10 during the 2005-06 academic year. The Atlantic 10 Conference is in its 28th year of NCAA Division I competition. The league’s members include Dayton, Duquesne, Fordham, George Washington, LaSalle, Massachusetts, Rhode Island, Richmond, St. Bonaventure, Saint Joseph’s, Temple and Xavier. Saint Louis University currently is a charter member of Conference USA. In early November, five C-USA member schools — Cincinnati, DePaul, Louisville, Marquette and USF — accepted invitations to join the Big East Conference. Five new schools — Central Florida, Marshall, Rice, SMU and Tulsa — filled C-USA’s vacant positions. For more details, visit www.slubillikens.com. Three new deans now on campus Dr. Ellen Harshman (Grad ’78, Law ’92) is the new dean of the John Cook School of Business. She succeeds the retiring Dr. Leroy Grossman, who was interim dean for one year. Harshman has served SLU in several leadership roles since 1972, including associate dean of the business school, director of the career planning and placement center and assis-tant to the vice president for student development. She also holds the rank of associate pro-fessor of management and most recently was SLU’s senior vice provost. Among her many responsibilities in this role, Harshman administered com- NEWS BRIEFS By The Numbers 4 National rank of Parks College of Engineering and Aviation’s aerospace engineering program, according to U.S. News and World Report. Overall, Parks’ undergraduate engineering pro-grams moved up three spots on the U.S. News list to No. 27. 498 Residents sponsored by SLU’s School of Medicine in 50 different residencies, subspecialty residencies and fellowships rotat-ing through eight affiliated teach-ing hospitals and 18 affiliated health care institutions. 8,742 Phone pledges made dur-ing fiscal year 2003 for a total for 1,067,000indonationstoSaintLouisUniversity.Thisisa23percentincreaseoverlastyearandthefirsttimethatmorethan1,067,000 in donations to Saint Louis University. This is a 23 per-cent increase over last year and the first time that more than 1 mil-lion has been raised through phoning. In September, SLU sponsored a two-evening gala event called “Denim & Diamonds” to benefit public education, research and treatment of liver disease. On Sept. 12, Willie Nelson headlined “Denim,” a concert to benefit the SLU Liver Center and the Julia Spears Foundation for Liver Disease. On Sept. 13, “Diamonds” fea-tured country music artist Naomi Judd, who spoke at a black-tie dinner to benefit SLU’s Liver Center. … Dr. Robert B. Belshe, Adorjan professor of infectious diseases and director of the Center for Vaccine Development, received the Clinical Virology Award for 2003 from the Pan American Society for Clinical Virology. … Sandra H. Johnson (A&S ’73), the Tenet Endowed Chair in Health Law and Ethics is one of four winners of the 2003 Pellegrino Medal for contribu-tions to health care ethics. … Dr. Marla Berg-Weger, pro-fessor and director of field service education for the School for Social Service since 1995, has been named associate provost. … Maria Whitehead, a member of Wake Forest’s 2002 NCAA Division I field hockey champi-onship team, is SLU’s new head field hockey coach. The appoint-ment is her first head coaching position. … Dr. Seung H. Kim, professor of international business and director of the Boeing Institute of International Business, has been appointed to serve on the Presidential Advisory Council for the Peaceful Reunification of the Republic of Korea. RESEARCH PLANS: Preliminary plans are under way for the design and site selection for a new research center at the Saint Louis University Health Sciences Center, part of an 80millioninvestmentinnewandrenovatedresearchspace.RaisingmoneyforthebuildingispartoftheUniversitys80 million investment in new and renovated research space. Raising money for the building is part of the University’s 300 million “Campaign for Saint Louis University: Where Knowledge Touches Lives.” pliance with the University’s accrediting agencies, served as a liaison with state-wide edu-cational agencies and oversaw the libraries, Reinert Center for Teaching Excellence and office of institutional study. Harshman has earned numer-ous honors during her SLU career and was named SLU’s Woman of the Year in 1981. Dr. Charlotte Royeen, a national leader in her field of occupational therapy, is the new dean of the Doisy School of Allied Health Professions. Royeen most recently served as associate dean for research at Creighton’s School of Pharmacy and Allied Health Professions and professor of occupational therapy. Prior to that, she was the founding chair and professor of occupa-tional therapy at Shenandoah University in Winchester, Va., and worked for several years for the U.S. Department of Education’s Office of Special Education Programs. Royeen holds a doctorate from Virginia Polytechnic Institute and State University in Blacksburg, Va., and a master’s degree in occu-pational therapy from Washington University School of Medicine. At the confer-ence of the American Occupational Therapy Association, Royeen received the 2002 Eleanor Clarke Slagle Lectureship Award, which is the highest scholarly achieve-ment bestowed in occupational therapy. Dr. Bjong Wolf Yeigh joined the Saint Louis University community July 1 as the dean for Parks College of Engineering and Aviation. He came to SLU from Yale University, where he was assis-tant provost of science and technology since 1999. He succeeds Dr. Charles Kirkpatrick, who was dean of Parks College for nine years and is on the department of chemistry faculty. Yeigh received a bachelor’s degree in engineering science from Dartmouth College, a master’s degree in mechanical engi-neering from Stanford and a doctorate in civil engineering and operations research from Princeton. A former tactical air intelligence officer assigned to Fighter Squadron 74, Yeigh served in the U.S. Navy dur-ing the Gulf War and for a total of eight years in active and reserve duties, leaving with a rank of lieutenant. Yeigh Royeen Harshman New technology VP on board Ellen Watson is Saint Louis University’s new vice president for information technology services. Although Watson may be new to SLU, she is familiar with the Jesuit mission. Before coming to SLU, she was the vice president of information service at Loyola University Chicago, a post she had held since 1999. Watson boasts 19 years of experience in her field, hav-ing served as associate vice president for information ser-vices and dean of library ser-vices at Indiana State University for four years and associate provost for informa-tion resources and technology at Bradley University for two years. She received her bach-elor’s degree from Wellesley College and her master’s from the University of Maryland. Drabble wins Literary Award Saint Louis University Library Associates pre-sented English author Margaret Drabble with the 2003 Saint Louis Literary Award at a ceremony Oct. 21. Drabble, a novelist, biog-rapher, critic and short story writer, is the author of The Seven Sisters, The Peppered Moth, The Witch of Exmoor and The Millstone. She is also editor of The Oxford Companion to English Literature. Drabble joins a dis-tinguished group of authors honored with this award dur-ing the past 36 years. Recipients include such luminaries as Arthur Miller, Joyce Carol Oates and Seamus Heaney. Last year’s winner was Joan Didion. Biodefense research brings schools together Anew research center based in St. Louis will play a major role in protecting the American public against bioterrorism and emerging infectious diseases. Washington University School of Medicine and Saint Louis University School of Medicine will be part of a multi-institutional Midwest Regional Center for Excellence in Biodefense and Emerging Infectious Diseases Research (MRCE). The cen-ter will be funded by a five-year, 35 million grant from the National Institute of Allergy and Infectious Diseases. The founding members of the MRCE also include Case Western Reserve University, the University of Missouri- Columbia and the Midwest Research Institute of Kansas City. The new center will concentrate on expanding cur-rent research efforts in biode-fense. For example, the team’s initial research effort will focus on poxvirus infections, which include diseases such as small-pox. The ultimate goals are to improve the safety of vaccines and to develop new therapies. Kavanaugh wins press award Saint Louis University phi-losophy professor and mag-azine columnist John Kavanaugh, S.J., (A&S ’65, Grad ’66, ’71) received top honors from the National Catholic Press Association. His “Ethics Notebook,” which regularly appears in America magazine, earned the Best Regular Column Award from Kavanaugh MIXING IT UP: What’s cooking in the department of nutrition and dietetics in the Doisy School of Allied Health Professions? Mark E. Miller, a certified executive chef, shown here supervising students Christina Bologna (left) and Diana Kingston, has joined the Saint Louis University faculty and is teaching future dietitians how healthy foods can be prepared to taste great. Miller, most recently a chef at Westborough Country Club, is sold on the University’s new, one-of-a-kind degree program that prepares students to become registered dietitians while they receive training for their culinary arts credential. “Our degree is perfect for stu-dents who want to work as personal chefs, among other spe-cializations,” Miller said. International HIV trial led by SLU Saint Louis University is leading an international vaccine trial to study a promising HIV prevention vaccine in humans. The trial is being conducted through the HIV Vaccine Trials Network (HVTN) of the National Institutes of Health. This is the first HVTN trial to be conducted simultane-ously in the United States and abroad — in St. Louis, Boston (through Harvard University) and Gaborone, Botswana — and it signifies a dedication to transcending borders in the fight against HIV. This vaccine has never been tested in humans. The trial is looking at the safety and immune response of an experimental HIV vaccine the association, which repre-sents 640 publications with a combined circulation of nearly 27 million in the United States and Canada. In honoring him, the National Catholic Press Association said: “Father Kavanaugh examines public issues through a moral lens and discusses them thoughtfully and powerfully.” 4 The December 1963 issue of Saint Louis University Magazine featured a cover photo of the new Griesedieck Memorial Hall, which was dedicat-ed Nov. 30, 1963. A news item mentioned that fund raising for Busch Memorial Center was under way — .1.5 mil-lion had been raised, and a 1.5millionloanhadbeensecured.Itwasestimatedthatthetotalcostofconstructionwouldbe1.5 mil-lion loan had been secured. It was estimated that the total cost of con-struction would be 3.25 million. The issue also highlighted the Midwest Assembly on Outer Space, a conference co-sponsored by SLU and held that September. The assembly brought together a cross section of leaders in education, gov-ernment, labor, business, industry, law, medicine, military and commu-nications from a 14-state area to consider the topic, “Outer Space: Prospects for Man and Society.” Participants included James E. Webb, the head of NASA, and U.S. Sen. Stuart Symington of Missouri. Another article featured an alum-nus, Robert Burns (Parks ’59), who was the first Missourian to join the Peace Corps. Burns was a land irri-gation specialist in Pakistan. Quotable UTAS: “It would be tragic if we were able to pinpoint rockets in space but unable to deter-mine where we were going as human beings.” — Charles A. Sheehan, Missouri state representa-tive and speaker at the Midwest Assembly on Outer Space Sign of the times: It was reported that tuition for the 1964-65 school year for full-time undergraduates and law students would be 575persemester,whichwasanincreaseof575 per semester, which was an increase of 100 over 1963-64 rates. School of Medicine students were slated to pay $700 per semester. SLU nabs C-USA GPA award again Conference USA has named Saint Louis University as the recipient of the Institutional Excellence Award for the eighth consecutive year. The award is given to the member school with the highest SLU listed as ‘Best Place to Work’ For the second time since 2000, Saint Louis University has made the St. Louis Business Journal’s “Best Places to Work” list. This year, SLU was honored in the “Best Practice” category — the only institution so recognized — for the development of Hometown SLU, which is designed to spur development near the St. Louis campus while assisting SLU employees looking to purchase a home in certain areas near campus. Since Hometown SLU was unveiled Feb. 5, 19 people have applied to the program and been approved. Full-time, eligible employees may receive f

    Universitas: the magazine of Saint Louis University

    No full text
    Summer 2018 issue of Universitas: the magazine of Saint Louis University. This is a special Bicentennial issue, celebrating the University's 200th anniversaryUNIVERSI TAS 2 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 1 BICENTENNIAL P R E S I D E N T ’ S M E S S A G E VOLUME 4 4, ISSUE 2 EDITOR Laura Geiser (A&S ’90, Grad ’92) ASSOCIATE EDITOR Amy Garland (A&S ’97) ART DIRECTOR Matt Krob CONTRIBUTORS Anne Marie Apollo-Noel Dr. Dolores Byrnes Molly Daily (Grad A&S ’18) Marie Dilg (Grad SW ’94) Sarah Hilgendorf ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER Detail of a window in St. Francis Xavier College Church depicting the north entry of DuBourg Hall flanked by graduates. The word “Christocracy” in red letters above the entry indicates Christ’s influence on education. The window was designed by Emil Frei Jr. and installed in the 1930s. Photo by J.J. Mueller, S.J. (A&S ’69, Grad A&S ’70) Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, One N. Grand Blvd., St. Louis, MO 63103. We accept email at [email protected]. Postmaster: Send address changes to Universitas, Saint Louis University, One N. Grand Blvd., St. Louis, MO 63103. Website: slu.edu/universitas Universitas is printed by Henry Wurst Inc. Worldwide circulation: 116,500 © 2018, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. Detail of two windows in St. Francis Xavier College Church that spotlight academic disciplines and sit on each side of the window on this issue’s cover. On the left, painting and music are depicted. On the right, mathematics and science are shown. PHOTOS BY J.J. MUELLER, S.J. PHOTO BY JAY FRAM F E ATU R E S D E PARTME NTS 10 The First Two Centuries A 200-year timeline of Saint Louis University — By Molly Daily 16 Always at the Frontier An excerpt from the official bicentennial book — By Dr. Dolores Byrnes 20 Exhibiting History The Saint Louis University Museum of Art’s new exhibition — Photos by Steve Dolan 24 Talking About My Generation Campus activities and hangouts since the 1940s — By Amy Garland 29 The Bicentennial Logo The hidden details of SLU’s 200-year mark — Designed by Matt Krob 30 More Than a Job Reflections from 10 longtime faculty and staff — By Marie Dilg 36 Cover Story Telling SLU’s history through its alumni magazines — By Laura Geiser 40 Making Good Time An update on the bicentennial service challenge — By Anne Marie Apollo-Noel 2 On Campus Major gift to the business school /// Madrid’s 50-year celebration /// 2018 commencement /// Climate Summit /// Prospect Yards /// Gift for nursing scholarships /// Literary Award to Sondheim 42 Class Notes 43 Alumni Spotlight Eric Moraczewski (CSB ’04) 46 In Memoriam 48 Feedback 49 The Last Look Our beloved University is worthy of celebration — both for the memorable achievements of our shared past and for the many impressive ways in which we live our mission today. We began this past academic year with the bicentennial Mass. As we planned it, I believed that it would be remembered as one of the very best moments in our history. An email I received from a parent of one of our students confirmed that to me. He said, “As I sat at the 200th anniversary Mass, with its gorgeous backdrop and significant history, I was brought to tears by the humbling appreciation that my daughter could attend a university like SLU.” This gratitude for SLU and our his-tory set the tone. More recently, as part of our bicentennial celebration, we hosted the Saint Louis Climate Summit and brought together world-re-nowned speakers Cardinal Peter Turkson, Dr. Mario Molina, Carl Pope and Bill Nye to examine a path forward for our planet. (Read more on page 5.) The Climate Summit was born out of the desire to respond to Pope Francis’ call to care for all of creation, especially our environ-ment, in his encyclical Laudato Si’. Chaired by SLU’s own Dr. Jack Fishman (Grad A&S ’74, ’77) and David Webb (A&S, CSB ’97, Grad ’12), and planned with support from Dr. Peter Raven and trustee Trudy Busch Valentine (Nurs ’80), the summit attracted meteorol-ogists; government leaders; experts in climate science, ecology and sustainable development; students; and engaged St. Louisans for three days of discussion. In affirmation of this summit, I received a letter from Cardinal Pietro Parolin, who is the secretary of state for the Vatican. In the letter, Cardinal Parolin quotes Pope Francis’ prayer that, “This gath-ering may serve to inform society more effectively on the issue of climate change and encourage the University community ‘to pro-mote best practice, to stimulate creativity in seeking new solutions and to encourage individual or group initiatives.’” In addition to these and other impressive events and academic programs, our bicentennial has inspired an outpouring of support from our community. Our stakeholders are demonstrating their belief in the importance of our work by investing in SLU. We are in the midst of the single greatest fundraising year in SLU history. Further, we are confident we will end this year at more than twice our previous all-time total. This February, trustee Dr. Richard Chaifetz (A&S ’75) and Jill Chaifetz made a transformational gift of 15milliontoourbusinessschool,bringingtheirlifetimecontributionstoSLUto15 million to our business school, bringing their lifetime contributions to SLU to 27 million. Their latest gift is intended to grow SLU’s nationally ranked entre-preneurship center and provide resources for other programs in the newly named Richard A. Chaifetz School of Business. (Read more on page 2.) Thank you to each of our alumni who have contributed to this historic fundraising year. Your gifts support innovation, academic excellence, scholarship and informed medicine. They will invigo-rate Saint Louis University, and reflect your confidence in our plan for the future. The very near future holds two outstanding opportunities for all of us to come together to celebrate SLU’s first two centuries. I hope you will join us for a Grand Celebration on Saturday, Sept. 29, during our special bicentennial Homecoming and Family Weekend. This evening will feature live music, food and fun activities for all ages. And on Thursday, Nov. 15, I invite you to a 200th birthday celebration featuring a private concert by the St. Louis Symphony Orchestra at Chaifetz Arena. As we all celebrate this historic milestone, our University is part-nering in shaping the direction of our region, and we are doing wonderful work in the classroom, in the laboratory, in the hospi-tal and in the community. Your support during our past and in the present is vital to our future. While you read, I hope you’ll learn new facts about your alma mater, reminisce about your time here and be inspired by the stories of those who shaped our beloved institu-tion. I would be delighted to hear your reflections. May God bless you, and may God continue to bless Saint Louis University. Dr. Fred P. Pestello President This special issue of Universitas takes you on a journey though Saint Louis University’s past. The timeline, book excerpt, faculty memories and photos that you will find on the following pages all serve to remind you of SLU’s noble history. UNIVERSI TAS 2 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 3 BICENTENNIAL Chaifetz Family Gift Leads to Business School’s New Name In February, SLU trustee Dr. Richard A. Chaifetz (A&S ’75) and his wife, Jill Chaifetz, increased their giving to Saint Louis University to 27million,including27 million, including 15 million to the business school. In 2007, the couple provided the lead gift of 12 million that enabled the construction of Chaifetz Arena. To honor this new, generous contribution, the University has renamed its business school the Richard A. Chaifetz School of Business and the school’s entrepreneurship center the Chaifetz Center for Entrepreneurship. SLU students, faculty and staff members turned out to thank Chaifetz during a special reception on Feb. 22. In his remarks, Chaifetz briefly told the story of how former SLU President Paul Reinert, S.J., allowed him to remain at SLU when financial issues threatened his ability to stay. Chaifetz promised Reinert that he would pay back his tuition — and that he would pay back the University in an even bigger way in the future. “This allows me to give back to a school I love, am passionate about and want to make even greater,” Chaifetz told the large crowd. “I want to hear the Chaifetz School of Business mentioned in the same breath as other great business schools.” The Richard A. Chaifetz School of Business has seven programs nationally ranked by U.S. News and World Report — three undergraduate and four graduate — including the country’s No. 9-ranked undergraduate entrepreneurship program. Chaifetz is a world-renowned entrepreneur and business leader, who in 1984 founded ComPsych Corp., today the world’s largest provider of employee assistance programs, behavioral health and wellness services. The company, of which he remains founder, chairman and CEO, provides services to more than 100 million individuals and 45,000 organizations in more than 160 countries. He also is founder and chairman of the private investment firm Chaifetz Group. He has been a member of SLU’s board of trustees since 2007 and was an inaugural member of the business school’s Entrepreneurial Hall of Fame. ON C AMPUS PHOTOS BY STEVE DOLAN Chaifetz addresses the crowd. Chaifetz (left) and SLU President Dr. Fred P. Pestello talk with students at the February event. Guests gathered in the in the Shanahan Atrium of Cook Hall listen to Chaifetz. UNIVERSI TAS 4 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 5 BICENTENNIAL 2018 Commencement Celebrates the Bicentennial With SLU’s bicentennial in mind, the University began a new tradition at the May 19 com-mencement ceremony at Chaifetz Arena as members of its Class of 1968 — now called Golden Billikens — led the entry procession and received special recognition. Golden Billikens will be honored at University commencements going forward. In another nod to the bicentennial, SLU reintro-duced its “Varsity Song,” which was written in 1909 and had not been performed at commencement since the 1960s. (See the original on page 19.) It was updated by Dr. Aaron Johnson, assistant professor of music, and sung by the University’s Mastersingers. More than 2,100 students graduated this spring. This year’s commencement speaker was Ronald Mercier, S.J., provincial of the Jesuits’ U.S. Central and Southern Province. He received an honorary doctor of divinity from the University. Also honored with honorary degrees during the ceremony were two SLU alumni, former U.S. Congressman William “Bill” Lacy Clay Sr. (A&S ’53) and former St. Louis Mayor Francis G. Slay (Law ’80). The student speaker from the graduating class was new law alumna Sarah Tomlinson. University archi-vist emeritus John Waide (A&S ’73) was the mace bearer. Climate Summit Draws Thousands Saint Louis University brought toge t her some of the most author-itative minds in climate science, ecology and sus-tainable development for the 2018 Saint Louis Cl imate Summi t thi s April. A highlight of SLU’s yearlong bicentennial celebration, the three-day summit was inspired by Pope Francis’ 2015 encyclical Laudato Si’ that called attention to humankind’s responsibility to care for the earth in the wake of climate change. Nearly 2,300 students, faculty and members of the St. Louis community attended the summit’s keynote address at Chaifetz Arena. The speakers were Carl Pope, former executive director of the Sierra Club and co-author of Climate of Hope: How Cities, Businesses and Citizens Can Save the Planet, and Bill Nye “The Science Guy,” well-known science educator and advocate. The summit featured experts from around the world, including Cardinal Peter Turkson, prefect of the Dicastery for Promoting Integral Human Development; Dr. Mario Molina, 1995 recipient of the Nobel Prize in Chemistry; recipients of various United Nations Environmental Awards; and members of the Pontifical Academy of Sciences, the primary scientific advisory council to the pope. Panelists presented about food security, water availability, rising sea levels, busi-ness issues related to climate change and more. More than 220 people attended the academic portion of the summit, which was shared worldwide online. The summit was organized by Dr. Jack Fishman (Grad A&S ’74, ’77), professor of earth and atmospheric sciences and director of SLU’s Center for Environmental Sciences, and David Webb (A&S, CSB ’97, Grad ’12), director of SLU’s Emerson Leadership Business Institute. Dr. Peter Raven, president emeritus of the Missouri Botanical Garden, and Trudy Busch Valentine (Nurs ’80), a SLU trustee, were key members of the planning team. During February and March, SLU competed in the annual nationwide RecycleMania competition, an eight-week event that raises awareness about campus sustainability. 8th year participating in RecycleMania 331,762 lbs. of single-stream recycling collected by SLU 86,267 lbs. of electronics collected during the E-Waste Drive 4th place in the national electronic recycling competition 25,721 lbs. of old documents shredded and recycled during ShredMania event 443,750 lbs. total diverted from landfills by SLU this RecycleMania IN ADDITION TO THE CLIMATE SUMMIT, HERE ARE A FEW HIGHLIGHTS OF THIS SPRING’S BICENTENNIAL EVENTS: O N C A M P U S BY THE NUMBERS RecycleMania Students volunteer at March’s E-Waste Drive, part of the national RecycleMania competition. SUBMITTED PHOTO Nye (left) and Pope give the keynote address at Chaifetz Arena. PHOTO BY SIMON NGUYEN INTERCULTURAL ORIGINS OF ST. LOUIS AND THE TRANS-MISSISSIPPI WEST, 1800-1840 This conference examined themes including the international influences present in early St. Louis, and the expansion of the St. Louis region. WOMEN AT SLU: THE STRUGGLE FOR KNOWLEDGE, POWER AND LEGACY This symposium discussed both the challenges and opportunities women confront as female students, staff and faculty at SLU. FROM SELMA TO ST. LOUIS: THEOLOGY OF MARTIN LUTHER KING JR., AND THE PURSUIT OF JUSTICE 50 YEARS LATER This public symposium offered performances and reflections on King’s legacy of liberation and justice. PHOTO BY SIMON NGUYEN Turkson (left) and Molina Confetti and streamers were released at the end of the ceremony in Chaifetz Arena. Graduates’ caps Honorary degree recipients (from left) Slay, Mercier and Clay Doisy College of Health Sciences graduates PHOTOS BY STEVE DOLAN UNIVERSI TAS 6 SUMMER 2018 SAINT LOUIS UNIVERSIT Y 7 BICENTENNIAL SLU, St. Louis Archdiocese Sign Agreement to Enrich Seminarian Education St. Louis Archbishop Robert J. Carlson and SLU President Dr. Fred P. Pestello signed an agree-ment in April that brings the Kenr ick-Glennon Seminary undergraduate program fully into SLU’s College of Philosophy and Letters, which oversees pro-grams for students training for the priesthood and ministry. Currently, seminarians take their first two years of undergraduate classes at SLU and finish their education at the seminary, receiving a degree from Kenrick- Glennon Seminary. Under the new agreement, seminarians will receive a Bachelor of Arts degree in philosophy from SLU, taking classes taught both at SLU and at the seminary. The program changes will be implemented for the 2018-19 school year. The seminarians will be able to explore other disciplines while at SLU. Carlson said he hoped that many would take advantage of the language arts and minor in Spanish, as the archdiocese has a growing Spanish-speaking population. Graduate Programs Earn High U.S. News Rankings The health law program in the Saint Louis University School of Law has been named the best in the nation by health law scholars for the 14th year, according to the 2019 U.S. News & World Report “Best Graduate School” rankings. The Center for Health Law Studies has been listed as a top program since the rankings were first published. Four programs in the Richard A. Chaifetz School of Business were ranked in the top 30 this year, including entrepreneurship, international business, supply chain management and accounting. SLU School of Nursing’s master’s program ranked among the top 50 out of more than 500 nursing graduate programs in the country. 1 Health Law 12 Entrepreneurship 13 International Business 15 Supply Chain Management 28 Accounting 28 Part-time Law 50 Best Nursing Programs – Master’s 51 Best Medical Programs – Primary Care 66 Best Nursing Programs – Doctor of Nursing Practice 70 Best Medical Programs – Research 88 Best Law Programs 163 Part-time MBA 194 Top Education Programs Atlas Week Celebrates SLU’s Global Connections The 2018 Sam and Marilyn Fox Atlas Week — “From Broken Walls, We Build Bridges: Out of Conflict Rises Community” — paid special attention to the ways that SLU students, faculty and staff members have forged connections beyond campus to improve the world. The week featured panels, presentations, film screenings, a soccer tournament, and other opportunities to experience the myriad cultures that make up the SLU community. A highlight was the keynote address by brothers Fred and Milton Ochieng’. Fred is pursuing cardiovascular medicine fellowship training at Saint Louis University; Milton is a gastroenterologist with the BJC Medical Group at Progress West Hospital. They spoke of their paths from their Kenyan community Lwala to medical school in the United States and beyond. The pair was orphaned and has used their medical educations to give back to Lwala through the creation of a community health clinic network. The week culminated with the traditional Parade of Nations and the Billiken World Festival. Ring Award Winner Dr. Lauren Arnold, associate professor of epidemiology in the College for Public Health and Social Justice, is the most recent recipient of the Nancy McNeir Ring Award, given by SLU’s chapter of Alpha Sigma Nu to a faculty member who has displayed a special dedication to students. Arnold addressed graduates during Midyear Commencement in December. In her address, she reminded the graduates to find joy in their decisions and to find good mentors Newly Named “Prospect Yards” District Connects SLU’s North and South Campuses In March, members of the Saint Louis University family, SSM Health and the community cast nearly 6,000 votes to name St. Louis’ newest district. The win-ning name? Prospect Yards. The 150-acre district connects SLU’s north and south campuses and is bordered by Laclede Avenue, Chouteau Avenue, Grand Boulevard and Vandeventer and Spring avenues. The district lies within Midtown in the same way that Cortex is part of St. Louis’ Central West End neighborhood and the Loop is part of University City. Prospect Yards includes projects such as the construction of the City Foundry STL and an Element by Westin hotel, as well as redevelopment of the Armory building. The name reflects the area’s early 20th-century roots, when the area west of Grand was known as the “Prospect Industrial District,” one of 17 industrial districts in the city and home to an extensive rail yard and many businesses. The umbrella developer for the larger, 400-acre area is St. Louis Midtown Redevelopment Corporation, which is owned by Saint Louis University and SSM Health. Stephen Sondheim Named 2018 St. Louis Literary Award Recipient The Saint Louis University Library Associates selected Stephen Sondheim, one of the most eminent lyricists and composers of the modern era, to receive the 2018 St. Louis Literary Award. He is the first musical lyricist to win the award since its inception in 1967. Sondheim will come to SLU in October to accept the award. In a career spanning 70 years, Sondheim has writ-ten the lyrics, music or both for some of the most iconic plays in the history of American theater, including West Side Story, Into the Woods, Sunday in the Park with George, Sweeney Todd and Gypsy. The award ceremony and conversation with the author, who will be interviewed by Muny artistic director Michael Isaacson (A&S ’86, Grad CSB ’96), is planned for Oct. 4. For more information, visit lib.slu.edu/about/associates. Med School Residency Program Receives Highest Accreditation Status The Accreditation Council for Graduate Medical Education, the accrediting body for medical residencies and fellowships, granted the School of Medicine continued accreditation, its high-est accreditation status. The status took effect Jan. 24, after a site visit earlier in the month. SLU is the sponsoring institution for 65 residency and fellowship programs at six area hospitals and many other clinical sites. 8.4 Million Gift to Nursing School Abequest gift totaling $8.4 million will allow the School of Nursing to create the Dr. and Mrs. Robert C. Hoppe Endowed Scholarship. The gift — the largest in the School of Nursing’s history and among the largest in SLU’s history — was made by the estate of Mary K. Hoppe (Nurs ’51, Grad Nurs ’59). “The Hoppes’ generosity in providing educational assistance for students will live eternally through the lives of the scholarship recipients and the countless numbers of patients each student touches,” Nursing Dean Dr. Teri Murray (Nurs ’79, Grad Nurs ’93, Grad Ed ’97) said. The nursing school plans to honor Hoppe and her husband, Dr. Robert Hoppe (Med ’51), at its 90th anniversary celebration this fall. Dois

    Universitas: the magazine of Saint Louis University

    No full text
    Winter 2020 issue of Universitas: the magazine of Saint Louis University.10 facts about SLU-Madrid Page 14 RECORD-SETTING CLASS Page 20 NEW CAREER CENTER Page 24 ST. LOUIS JESUITS’ CONCERT Page 26 FACULTY EXPERT ON VICE PRESIDENCY Page 30 WINTER 2020 | 1 VOLUME 46, ISSUE 1 EDITOR Laura Geiser (A&S ’90, Grad ’92) ASSOCIATE EDITOR Amy Garland (A&S ’97) ART DIRECTOR Matt Krob CONTRIBUTORS Jessica Ciccone Marie Dilg (Grad SW ’94) ON CAMPUS NEWS STORIES University Public Relations Billiken Media Relations ON THE COVER SLU-Madrid students in Plaza Mayor in the heart of Madrid Photo by Fernando Béjar Universitas is published by Saint Louis University. Opinions expressed in Universitas are those of the individual authors and not necessarily those of the University administration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 1 N. Grand Blvd., St. Louis, MO 63103. We accept email at [email protected]. Postmaster: Send address changes to Universitas, Saint Louis University, 1 N. Grand Blvd., St. Louis, MO 63103. Website: slu.edu/universitas Universitas is printed by Breese Printing and Publishing Worldwide circulation: 123,557 © 2020, Saint Louis University All rights reserved. Reproduction in whole or in part without permission is prohibited. New and returning students gather at the first 9 p.m. Mass of the school year in St. Francis Xavier College Church. PHOTO BY STEVE DOLAN F E ATU R E S D E PARTME NTS 14 ¿Sabías? Ten facts about SLU-Madrid that might surprise you. — By Laura Geiser 20 Top Class The freshman class is the largest in SLU’s history. — By Marie Dilg 24 Beyond Career Fairs SLU’s Career Services focuses on preparing students for life after SLU. — By Marie Dilg 26 Coming Home The St. Louis Jesuits music group says farewell with a sold-out concert. — By Amy Garland 30 Vice Presidential VIP Law professor Joel K. Goldstein is the nation’s top VP expert. — By Jessica Ciccone 2 On Campus Women’s soccer A-10 championship /// Record fundraising year /// Nursing school’s new name /// Midtown development update /// Rankings /// Opus Prize 34 Class Notes 35 Alumni Spotlight Angela Lewis (A&S ’04, Grad A&S ’07) 36 How I Got Here Jim Dean (CSB ’88) 40 Letters to the Editor 41 In Memoriam 44 By the Numbers 45 The Last Look That is certainly what our campus in Spain aims to achieve — and accom-plishes with great success. From signage to statutes, SLU-Madrid succeeds at carrying out our branding. But much more than that, it lives our mission. This campus shares our vision for building a better world with more Jesuit-educated graduates. To do so on the global stage is a testament to the power of a SLU education. The stories I hear from our students, both when I visit SLU-Madrid and those who come back to St. Louis after spending time studying abroad, never cease to amaze me. Their stories and experi-ences remind me why I was called to higher education. As you will see in this issue, our students absorb culture through their time with señoras, or host families, who help broaden their perspective of Spanish culture. (Read more on page 16.) Learning does not stop when our students leave class — and in this increas-ingly connected world, it is more important than ever to lead them to become informed global citizens. The excitement we feel at SLU crosses international waters, and I’m thrilled this issue brings you a flavor of the pride we feel for our Madrid and St. Louis campuses. From regional development to record-breaking enrollment and fundraising, we certainly look forward to sharing our good news. The start of our third century and SLU-Madrid’s 52nd year brought a record-setting year for us at Saint Louis University. Our freshman class in St. Louis broke all enrollment records with 1,900 students, surpassing our previous largest class by 200 students. (Turn to page 22 to learn more.) SLU-Madrid continues to draw hundreds of students from dozens of countries who learn and grow together. And thanks to our generous donors, we once again raised a record amount in gifts for scholarships, academics, research and other ini-tiatives. We are well on our way to our 500milliongoalinourcampaign,knownasAcceleratingExcellence:TheCampaignforSaintLouisUniversity.(Seethestoryonpage10.)Whilewecertainlycelebratetheseachievements,wewillneverrestonthem.Thatsthejoyandthechallengeofacademiaalwaysplanningandadaptingfortheeverchangingworldinwhichweoperate.Themanywaysinwhichwemeetthoseneedsisbroad.Forexample,regionaldevelopmentandthephysicalchangesacrosscampus.AswelooktoourUniversitysfuture,wecontinuetofocusonopportunitiesthatwillstrengthentheUniversityforgenerationstocome.YouwillreadmoreinthisissueaboutafewexamplesoftheburgeoningdevelopmentintheMidtownSt.Louisarea.Theseincludeprojectsonandoffcampus.MomentumandexcitementcontinuetobuildforournewInterdisciplinaryScienceandEngineeringBuilding,andwearethrilledthatprogresscontinuesonthenew,500 million goal in our campaign, known as Accelerating Excellence: The Campaign for Saint Louis University. (See the story on page 10.) While we certainly celebrate these achievements, we will never rest on them. That’s the joy and the challenge of academia — always plan-ning and adapting for the ever-changing world in which we operate. The many ways in which we meet those needs is broad. For exam-ple, regional development and the physical changes across campus. As we look to our University’s future, we continue to focus on opportunities that will strengthen the University for generations to come. You will read more in this issue about a few examples of the bur-geoning development in the Midtown St. Louis area. These include projects on and off campus. Momentum and excitement continue to build for our new Interdisciplinary Science and Engineering Building, and we are thrilled that progress continues on the new, 550 million SSM Health Saint Louis University Hospital and Ambulatory Care Center. All will open this fall. SLU is also proud to be involved in developments that lead the resurgence taking place in the city’s central core, such as the redevel-opment of homes in the Gate District West neighborhood near the hospital, and the forthcoming City Foundry. (Read more on page 13.) As we share in the story about Gate District West, we are grate-ful to our St. Louis community neighbors for sharing our vision for and commitment to growing stronger together. In closing, I ask that you remember how these stories and the many initiatives behind them help fulfill our noble mission. I also ask that you share our exciting news with those you know who are young — or young at heart — who are seeking higher edu-cation. Tell them about SLU and your experience. Our world always benefits from more truth-seekers and servant leaders who are Jesuit educated. May God bless you and Saint Louis University. Dr. Fred P. Pestello President I cannot tell you what it’s like to step off of a plane after an eight-hour flight to Europe, only to walk onto a campus that feels just like home. Or perhaps I don’t have to tell many of you — those of you who have studied at or visited SLU-Madrid, or our international students in St. Louis. PRESIDENT’S MESSAGE PHOTO BY FERNANDO BÉJAR Pestello talks with students outside of San Ignacio Hall at SLU-Madrid. 2 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 3 ON CAMPUS Women’s Soccer Wins A-10 Again The Billikens women’s soccer team defeated George Washington 3-1 in the Atlantic 10 Conference Championship title game in November, securing its second straight A-10 Championship crown. Senior Courtney Reimer was named the most outstanding player of the championship. Senior Emma Farley, sophomore Hannah Friedrich, senior Alli Klug and graduate student Mary Niehaus joined her on the All-Championship team. Over the season, SLU extended its school-record unbeaten streak to 16 games. Already the winningest class in SLU women’s soccer history, the Billiken seniors registered their 64th victory. The team lost to Notre Dame in the first round of the NCAA Championship. Reimer Celebrating with the A-10 trophy Reimer (center) hugs Annabelle Copeland (left) and Farley. Farley The team celebrates at Robert R. Hermann Stadium on campus. PHOTOS BY BILL BARRETT 4 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 5 ON CAMPUS University Offers New Academic Programs, Begins Comprehensive Review Process Saint Louis University began offering many new academic programs in the fall, including: UNDERGRADUATE Bachelor of Arts in Leadership and Organizational Behavior Bachelor of Science in Health Care Ethics Minor in Dance GRADUATE Master of Science in Biostatistics and Health Analytics Doctorate in Education Policy and Equity GRADUATE CERTIFICATES American Studies Cybersecurity Strategic Intelligence Women’s and Gender Studies The University also started a formal review of its academic programs. In spring 2019, the provost established the Academic Portfolio Review Committee, tasked with analyzing and making recommendations to the provost about the size and academic scope of the University’s portfolio of offerings. This process will eventually become a regular assessment tool for all graduate and undergraduate programs. Led by faculty, the committee has representatives from the student body and administration. Dr. Mark Knuepfer, a professor in the School of Medicine, serves as the committee chair. Signature Beam: Students, faculty and staff signed their names and good wishes on the beam that would complete the topping-out of SLU's new Interdisciplinary Science and Engineering Building. Saint Louis University leaders, St. Louis Mayor Lyda Krewson, trustees, students, faculty and staff members marked the topping-out of the University’s new 50millionISEBuildingonDec.6.Thebuildingwillopenintimeforclassesthisfall.PHOTOBYAMELIAFLOODSLUNamesNursingSchooltoHonorTrudyBuschValentineInAugust,SaintLouisUniversityannouncedthatUniversitytrusteeTrudyBuschValentine(VSN80)madeagiftof50 million ISE Building on Dec. 6. The building will open in time for classes this fall. PHOTO BY AMELIA FLOOD SLU Names Nursing School to Honor Trudy Busch Valentine In August, Saint Louis University announced that University trustee Trudy Busch Valentine (VSN ’80) made a gift of 4 million in support of the School of Nursing and Accelerating Excellence: The Campaign for Saint Louis University. In recognition of Valentine’s history of philan-thropic support of SLU totaling nearly 7million,theUniversityrenameditsnursingschooltheTrudyBuschValentineSchoolofNursingandhostedadedicationduringHomecomingandFamilyWeekend2019.ValentinesgiftwasmadeinhonorofformerdeansDr.TeriMurray(VSN79,GradVSN93,GradEd97)andthelateDr.JoanHrubetz(VSN60,GradEd70,75)fortheirlegacyofleadershipofthenursingschool.Thegiftwillsupportfacultydevelopmentaswellascontinuedacademicexcellenceamongtheschoolsfacultyinteaching,research,scholarshipandleadership.ValentinehasbeenamemberoftheSaintLouisUniversityWomensCouncilsince1990.ShejoinedtheSchoolofNursingExecutiveAdvisoryboardin2000,assumingthechairpersonrolefrom2006to2015.ShewaselectedtoSLUsboardoftrusteesin2017.ValentineandherfamilyhavebeensupportersofSLUsnursingschoolforyears.Hermother,GertrudeBuholzerBusch,establishedanundergraduatescholarshipandtheJoanHrubetzEndowedChair.In2012,ValentineandherdaughterChristinaValentineCammon(VSN12)establishedtheTrudyandChristinaBuschValentineEndowedLectureSeries.Nursinghasmademerespectpeoplefromallwalksoflife,andithasopenedmyheart,mindandlifetothewellbeingofothers,Valentinesaid.ImsoproudtobepartofaprofessionthatcaressodeeplyaboutpeopleandcanmakesuchapositiveimpactonthelivesofothersaprofessionthatlivesSLUsJesuitmissiontoseekahigherpurposeforthegreatergood.IamsogratefultotheSaintLouisUniversitySchoolofNursingandveryhappytohonorDeanTeriMurray,adearfriendandmentor,forhermanyyearsofserviceandmagnificentleadership.Anactiveconservationistandphilanthropist,ValentinealsohasworkedasavolunteernurseattheSalvationArmyResidenceforChildren,MercyHospitalandtheVisitingNurseAssociationHospiceprogram.ValentinePHOTOBYSTEVEDOLANNOTEWORTHYGRANTSGERIATRICCAREINMISSOURI7 million, the University renamed its nursing school the Trudy Busch Valentine School of Nursing and hosted a dedication during Homecoming and Family Weekend 2019. Valentine’s gift was made in honor of former deans Dr. Teri Murray (VSN ’79, Grad VSN ’93, Grad Ed ’97) and the late Dr. Joan Hrubetz (VSN ’60, Grad Ed ’70, ’75) for their legacy of leadership of the nursing school. The gift will support faculty development as well as continued academic excellence among the school’s faculty in teaching, research, scholarship and leadership. Valentine has been a member of the Saint Louis University Women’s Council since 1990. She joined the School of Nursing Executive Advisory board in 2000, assuming the chairperson role from 2006 to 2015. She was elected to SLU’s board of trustees in 2017. Valentine and her family have been supporters of SLU’s nursing school for years. Her mother, Gertrude Buholzer Busch, established an undergraduate schol-arship and the Joan Hrubetz Endowed Chair. In 2012, Valentine and her daughter Christina Valentine Cammon (VSN ’12) established the Trudy and Christina Busch Valentine Endowed Lecture Series. “Nursing has made me respect people from all walks of life, and it has opened my heart, mind and life to the well-being of others,” Valentine said. “I’m so proud to be part of a profession that cares so deeply about people and can make such a positive impact on the lives of others — a profession that lives SLU’s Jesuit mission to seek a higher purpose for the greater good. I am so grateful to the Saint Louis University School of Nursing and very happy to honor Dean Teri Murray, a dear friend and mentor, for her many years of service and magnificent leadership.” An active conservationist and philanthropist, Valentine also has worked as a volunteer nurse at the Salvation Army Residence for Children, Mercy Hospital and the Visiting Nurse Association Hospice program. Valentine PHOTO BY STEVE DOLAN NOTEWORTHY GRANTS GERIATRIC CARE IN MISSOURI 3.75 million Supported by a five-year grant from the U.S. Department of Health and Human Services, Dr. John Morley, professor of internal medicine, and Dr. Marla Berg-Weger, executive director of SLU’s Geriatric Education Center and professor of social work, will partner with multiple educational, patient care and service organizations in educating, studying and caring for older adults. COMMUNICATION WITH PARENTS OF SICK CHILDREN 3.26millionDr.VernaHendricksFerguson,theIreneRiddleEndowedProfessorofNursingatSLU,isaprincipalinvestigatorforthisfirstofitskindstudy.Thegoalofthefiveyearstudyistoseeifearlypalliativeandendoflifecarediscussionsatthetimeofachildscancerdiagnosiswillimprovethequalityoflifeforparentsandtheirchildren.NONADDICTIVEPAINKILLEROPTIONS3.26 million Dr. Verna Hendricks-Ferguson, the Irene Riddle Endowed Professor of Nursing at SLU, is a principal investigator for this first-of-its-kind study. The goal of the five-year study is to see if early palliative and end-of-life care discussions at the time of a child’s cancer diagnosis will improve the quality of life for parents and their children. NON-ADDICTIVE PAINKILLER OPTIONS 2.1 million Addressing the need for better pain medications, Dr. Daniela Salvemini and her colleagues at the Henry and Amelia Nasrallah Center for Neuroscience at SLU will investigate a promising pain-signaling pathway in the hopes of opening up a new avenue for pain medication research. CELLULAR CHANGES WITH HEART DISEASE, DIABETES 1.8 million Chemistry professor Dr. Jim Edwards (A&S ’99, Grad A&S ’01) received this National Institutes of Health grant to understand cellular changes that could lead to better therapies for diabetes and heart disease. Dr. Chris Arnatt, assistant professor of chemistry at SLU, is also a principal investigator. OBESITY, CANCER IMMUNOTHERAPY 1.7 million Dr. Ryan Teague, associate professor of molecular microbiology and immunology, will study how obesity influences outcomes for cancer patients being treated with immunotherapy. ANTI-DIARRHEAL DRUG 1.65millionAssociateprofessorofchemistryDr.MarvinMeyerswillusethisNationalInstitutesofHealthgranttofocusonintelligentdrugdesignfindingnewdrugsforinfectiousdiseasesthatkillmillionsandaredevastatingforthepoor.Dr.DaveGriggs,associateprofessorofmolecularmicrobiologyandimmunology,isanotherprincipalinvestigator.SLUStartupRaises1.65 million Associate professor of chemistry Dr. Marvin Meyers will use this National Institutes of Health grant to focus on intelligent drug design — finding new drugs for infectious diseases that kill millions and are devastating for the poor. Dr. Dave Griggs, associate professor of molecular microbiology and immunology, is another principal investigator. SLU Startup Raises 30 Million in Bid to Better Manage Pain In one of the biggest investments in research com-mercialization in Saint Louis University’s history, BioIntervene, a biopharmaceutical company founded in 2014 by SLU pharmacologist Dr. Daniela Salvemini has raised 30millioninseriesAfundingfromMPMCapital.TheinvestmentwillpropelSalveminisdiscoveriesforwardandsetthestagetobeginPhaseIclinicaltrialsforanewnonaddictivepainkillerlaterthisyear.Salvemini,whoisprofessorofpharmacologyandphysiologyanddirectoroftheHenryandAmeliaNasrallahCenterforNeuroscienceatSLU,pioneeredresearchonatreatmentforneuropathicpainthatcouldprovidethefirstalternativetoineffectivesteroidsandaddictiveopioids,amarketprojectedtoreach30 million in series A funding from MPM Capital. The investment will propel Salvemini’s discov-eries forward and set the stage to begin Phase I clinical trials for a new non-addictive painkiller later this year. Salvemini, who is professor of pharmacology and phys-iology and director of the Henry and Amelia Nasrallah Center for Neuroscience at SLU, pioneered research on a treatment for neuropathic pain that could provide the first alternative to ineffective steroids and addictive opi-oids, a market projected to reach 8.3 billion by 2024. Neuropathic pain affects between 15 and 20 million people in the United States. Exceedingly difficult to treat, this type of pain can occur after injuries to the nervous system due to trauma, disease or exposure to neurotox-ins, including after chemotherapy. There is a need for new medications that do not cause side effects and addic-tion the way narcotic pain killers do. “Having the opportunity to translate one’s discover-ies from the bench to the bedside is a dream come true,” Salvemini said. “I am hopeful that our efforts will lead to the alleviation of suffering while helping end the opi-oid crisis.” Salvemini discovered that alterations in signaling within the body contribute to the development of chronic pain states and that compounds that target a key recep-tor can “turn off” pain signals, providing relief from chronic pain of various types. This discovery, she noted, provided the starting point of her collaboration with Dr. Kenneth Jacobson, chief of the molecular recognition section, in the laboratory of bioorganic chemistry at the National Institutes of Health. Salvemini SUBMITTED PHOTO 6 | UNIVERSITAS | THE ALUMNI MAGAZINE OF SAINT LOUIS UNIVERSIT Y WINTER 2020 | 7 ON CAMPUS SLU Research Institute Grants Second Round of Funding The Saint Louis University Research Institute awarded its second round of funding last summer: More than 740,000wasgivento13facultymembersthroughtheResearchGrowthFund.Morethan70proposalshadbeensubmitted.LaunchedinSeptember2018throughagiftfromDr.JeanneandRexSinquefield(CSB67)thelargestgiftinUniversityhistorytheSLUResearchInstitutefurthersSLUsgoalofbecomingtheworldsleadingJesuitresearchuniversity.ThefirstroundofgrantswasannouncedinJanuary2019,withatotalof740,000 was given to 13 faculty members through the Research Growth Fund. More than 70 proposals had been submitted. Launched in September 2018 through a gift from Dr. Jeanne and Rex Sinquefield (CSB ’67) — the largest gift in University history — the SLU Research Institute furthers SLU’s goal of becoming the world’s leading Jesuit research university. The first round of grants was announced in January 2019, with a total of 1.8 million going to 15 faculty members. Among the 13 faculty who received grants in this second round are: Miriam Cherry, professor and co-director of the William C. Wefel Center for Employment Law, who will study methods of online justice such as amateur sleuths gathering online to collect clues in cold cases, workers sharing information online about abusive labor practices and people using the Internet to mount harassment campaigns. Dr. Terra Edwards, assistant professor of anthropology, who will finish a book manuscript, Going Tactile: Life at the Limits of Language. Her research focuses on the protactile movement, which advances the claim that hearing and vision are not necessary for things like greeting people or joining or leaving a conversation. Dr. David Ford (A&S ’80), professor of biochemistry and molecular biology and director of the Center for Cardiovascular Research, who will use new technology to investigate endothelial and epithelial barrier dysfunction. This technology will be used in the planning for a SLU Sepsis Center and the SLU Institute for Drug and Biotherapeutic Innovation. Jesuits Reckon with the Legacy of Slavery In late August, Jesuits of the USA Central and Southern (UCS) Province began contacting individuals believed to be descen-dants of people held in slavery by 19th century Jesuits, including at Saint Louis University. This is the latest work of the Slavery, History, Memory and Reconciliation Project, which started in 2016 as a joint initiative of the UCS Province and the University. The goal is to find a path to reconciliation by illuminating the lives of the people who were enslaved and connecting with their descendants. Historians have long known that when Jesuits established mis-sions in St. Louis, they relied on the labor of enslaved people to help those missions survive. To reveal the stories of courage and resil-ience among those who were enslaved and to trace their families forward, researchers have combed through thousands of docu-ments, including financial ledgers, Church records and personal journals. Dr. Jonathan Smith, SLU’s vice president for diversity and com-munity engagement, is leading the project for the University. To undertake a conversation about SLU’s next steps, Smith plans to assemble a working group that will include students, faculty, staff, alumni, trustees and descendants. To learn more about the project and to read the stories about the people who were enslaved, visit shmr.jesuits.org. SLU Launches Geospatial Institute Anew Geospatial Institute at Saint Louis University will support research, training and innovation in the rapidly growing fields of geospatial science and technology. Also known as GeoSLU, the institute brings together faculty and students from various disciplines to use geospatial research tools to solve challenges and to enhance graduate and undergraduate education. The institute’s primary areas of research will include artificial intelligence, machine learning and informatics. In launching the Geospatial Institute, SLU seeks to strengthen collaborations with other universities, including the University of Missouri System schools, Washington University in St. Louis and Harris-Stowe State University, as well as innovation partners in the region, including Cortex and T-Rex. GeoSLU also builds upon SLU’s existing relationship with the National Geospatial-Intelligence Agency (NGA). In January 2019, the University signed a partnership agreement with the NGA, and the organizations partnered on the GeoResolution conference last April. Dr. Vasit Sagan, associate professor of earth and atmospheric sciences, is the institute’s faculty director. Robert Cardillo, former director of the NGA, advises the institute as part of his work as a distinguished geospatial fellow at SLU. For more information, visit slu.edu/geoslu. Nancy McNeir Ring Award Presented for Excellence in Teaching Dr. Katie Kelting, assistant professor of mar-keting in the Richard A. Chaifetz School of Business, was selected as the recipient of SLU’s 2019 Nancy McNeir Ring Award for excellence in teach-ing. Lauded by students for her emphasis on teaching them the value of ethics in the business world, Kelting joined the SLU faculty in July 2016 and is director of the business school’s Behavioral Research Lab. On a national level, she is a Women in the Marketing Academy Fellow, among her many fellowships. She addressed graduates during December’s midyear commencement at Chaifetz Arena. Kelting PHOTO BY STEVE LONG PHOTO BY STEVE DOLAN Special Guest Star: The Stanley Cup makes a stop on campus during Homecoming and Family Weekend 2019, giving fans of the 2019 NHL champion St. Louis Blues hockey team the opportunity to make lasting memories. SLU, Urban League Honor MLK’s Legacy At their annual memorial tribute honoring civil rights leader the Rev. Dr. Martin Luther King Jr. on Jan. 16, Saint Louis University and the Urban League of Metropolitan St. Louis honored those carrying forward King’s legacy of activism and advocacy for racial equity and justice across the St. Louis region. The keynote speaker, noted journalist and author Roland Martin, told the crowd in SLU’s Busch Student Center that “leaders step up when it’s time to lead.” He chal-lenged those attending the tribute to recall King not as a mascot, but for his radical commitment to social justice a

    Universitas: the magazine of Saint Louis University

    No full text
    Summer 2006 issue of Universitas: the magazine of Saint Louis UniversityS i n g i n g g roup wo r k s i n h a r mo n y pg. 9 B i o l o gy fac ult y m a k e t he ir m a r k pg. 12 A l um n i c h a n g e c hil d r e n’s l i v e s pg. 18 B a s e b a l l t e a m p l ay s i n n c a a t our n a me n t pg. 6 F E AT U R E S DE PA R TMEN T S E d i t o r Laura Geiser (A&S ’90, Grad ’92) C o n t r i b u t o r s Allison Babka Burney Marie Dilg (SW ’94) Shannon McGuire (Student Assistant) Rachel Otto “ O n C a m p u s ” n e w s s t o r i e s University Communications Medical Center Media Relations Billiken Media Relations D e s i g n Art Direction: Matthew Krob Universitas is published by Saint Louis University. Opin-ions expressed in Universitas are those of the individual authors and not necessarily those of the University admin-istration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publication should indicate that fact. The editor reserves the right to edit all items. Address all mail to Universitas, DuBourg Hall 39, 221 N. Grand, St. Louis, Mo. 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, Universitas. Postmaster: Send address changes to Universitas, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html Universitas is printed by Universal Printing Co. and mailed by Specialty Mailing. Worldwide circulation: 111,720 © 2006, Saint Louis University All rights reserved. Volume 3 2 , I ssue 3 In April, I had the privilege of speaking to a group of outstanding local citizens to accept St. Louis’ 2005 “Citizen of the Year” award, which is presented by a committee of former recip-ients and sponsored by the St. Louis Post-Dispatch. It was truly an honor. The humbling experience gave me the oppor-tunity to reflect on my early days in my adopt-ed hometown and how much I have seen things change here during the last 19 years. Although I had a very brief visit to St. Louis in 1967 on my way to Mexico to hone my Span-ish skills, I didn’t spend any time in the city until I was named to Saint Louis University’s board of trustees in 1983. On my first trip to SLU for a board meeting, I extended my stay so I could see the city. After taking the Lindell Boulevard bus downtown on a Saturday after-noon, I found so little to do that I caught an earlier flight back to Chicago. For four more years, I came to St. Louis for the trustees’ quarterly meetings — and I came only for the meetings. Then, in 1987, when I was elected president of SLU, I decided that I had to get to know the city. One Sunday morning shortly after my arrival, I took former SLU President Tom Fitzgerald’s old, green-colored Oldsmobile and drove around downtown, trying to memorize the street names. I saw progress. In four years, some things had certainly changed for the better. But as I drove back to campus, I saw that there was still much to do. Right in Midtown, in my own new back yard, there were dilapidated buildings, plots of asphalt and rundown city blocks. In my early days at SLU, I was like a new homeowner. I wanted the best for my neighborhood, and I was willing to make the effort to improve it. When I came to this city to live and work, I quickly adopted it as my home. But I still needed a shot of hometown pride. I found that pride away from buildings and ball clubs. I love St. Louis for more than its Arch, toasted ravioli and Ted Drewes frozen custard. I love it for the people who are trying to make a dif-ference — visionaries such as Joe Edwards and Richard Baron and many others. And while I did use my “Citizen of the Year” acceptance speech as an opportunity to challenge my fellow St. Louisans to aspire to make our city greater, I also know that I — and our University — have enjoyed unprec-edented cooperation from city officials and local business leaders. I can remember being here for just a few months and working with then-mayor Vince Schoemehl (Grad ’86) to get trees — substantial trees — planted along Grand and Lindell. In Chicago, I would have never had as much direct access to the Board of Aldermen or to the mayor himself. Today, we continue to receive tremendous support from Mayor Francis Slay (Law ’80) and from the Board of Aldermen. I am truly grateful for the trust that city officials have always placed in SLU. And it’s not just the civic leaders who have given us their trust. You, our alumni, friends and do-nors, have shown how you believe in us, too. Through your gifts of time, talent and treasure, you’ve been instrumental in building the reputation and stature of Saint Louis University. We’ve come a long way together. And the city of St. Louis has, too. I am so thankful for your commitment to Saint Louis University and hope that — no matter where you live now — SLU and St. Louis will always feel like home. Lawrence Biondi , S. J . photo by Steve Dolan President’s Message etrolink On the Map A special insert gives you an up-close look at SLU’s campus. Map Illustration by Robert North Jr. U N I V E R S I TA S S UMME R 2 0 0 6 Fr. Biondi with Dr. Donald Suggs, publisher of the St. Louis American and the 2004 Citizen of the Year. 2 On Campus Arena plans taking shape Research Building gets a name Commencement U.S. News ranks SLU high again Social justice magazine debuts 6 Billiken News Baseball team goes to the NCAA Tournament Walker is now a coach 7 Campaign Update Meet Anna and Jesse, students doing their part for annual giving 22 Class Notes Catch up with classmates 28 In Memoriam Remembering those members of the SLU community who recently died 29 Off the Shelf Seven books from the SLU community 30 Alumni Events Find SLU alumni activities wherever you live 32 Perspective An alumnus turns from music fan into record label owner 33 The Last Word Letters to the editor 9 Brothers in Song An introduction to the Bare Naked Statues, SLU’s all-male a cappella group. By Allison Babka Burney Bio-Diversity The biology department faculty are studying everything from fish to wasps to liver cancer. By Marie Dilg A Haven of Hope Two alumni have created a home where abused and neglected children thrive. By Marie Dilg 12 18 Students congregate around a fountain at the Medical Center on a hot June aftternoon. Photo by Kevin Lowder U N I V E R S I TA S w w w. s l u . e d u U N I V E R S I TA S S UMME R 2 0 0 6 Groundbreaking is less than three months away for the new 80.5millionSaintLouisUniversityArena.AtitsMaymeeting,theUniversitysboardoftrusteesgavetheauthorityforgroundbreakingtotakeplacebySeptemberfortheoncampus,multipurposeArena.AlsoinMay,SLUannouncedthatSt.LouisbasedClaycohasbeenchosentobuildtheArenaontheeasternendofcampus.Claycowilloverseeconstructionofa10,600seatbasketballArena,apracticefacilityandathleticdepartmentofficesandsupportfacilities.TheArenawillbehometoBillikenmensandwomensbasketballaswellasconcerts,familyshows,tradeshows,commencementsandmanyotherevents.PhiladelphiabasedGlobalSpectrumhasbeenselectedtomanagetheArenaandassistinpreopeningactivities.TheArenawillbefundedthroughfundraising,80.5 mil-lion Saint Louis University Arena. At its May meeting, the University’s board of trustees gave the authority for groundbreak-ing to take place by September for the on-campus, multipurpose Arena. Also in May, SLU announced that St. Louis-based Clayco has been chosen to build the Are-na on the eastern end of campus. Clayco will oversee construction of a 10,600-seat basketball Arena, a practice facility and athletic depart-ment offices and support facilities. The Arena will be home to Billiken men’s and women’s basketball as well as concerts, family shows, trade shows, commencements and many other events. Philadelphia-based Global Spectrum has been selected to manage the Arena and as-sist in pre-opening activities. The Arena will be funded through fund raising, 8 million in TIF funding and bonds, which will be paid off with revenues from the Arena. Fund raising continues toward the 39 million goal for the Arena project. Alumni and benefactors who would like to contribute to the Arena project can get information about the project online at arena.slu.edu, or by calling (314) 977-2499. Site preparation will begin this summer, with a groundbreaking date in late August or early September. Construction is expected to take approximately 19 months and be completed in March 2008. At 10,600 seats, the Saint Louis University Arena will have the second largest capacity in the Atlantic 10 Conference. The University anticipates hosting more that 90 events in the Arena in its first year of operation, with roughly half being non-University events. Arena plans move forward; groundbreaking soon Commencement 2006 Saint Louis University celebrated commencement for more than 1,700 graduates May 20 at Savvis Center. Chris Lowney, author of Heroic Leadership: Best Practices from a 450-Year-Old Company that Changed the World, delivered the com-mencement address. The book takes the pil-lars of Ignatian teachings and applies them to today’s business environment. In addition to Lowney, other honorary degree recipients were Maurice B. McNamee, S.J. (A&S ’33, Grad ’34, ’45), professor emeritus of Eng-lish, professor emeritus of art and art history and director emeritus of Samuel Cupples House; and Frank Stroble (Cook ’52, Grad ’60) and Ruth Stroble, longtime supporters of Catholic higher education and commu-nity volunteers. Throughout five decades as a professor at Saint Louis University School of Medicine, Dr. Edward A. Doisy was renowned worldwide for his pioneering work in the field of biochemistry, including win-ning the 1943 Nobel Prize for discovering the chemical nature of vitamin K. To honor his lifetime of work, SLU’s new biomedical research tower, a 67 million fa-cility, will be named the Edward A. Doisy Research Center. The Doisy family has com-mitted 30millionforconstruction.TheannouncementwasmadeduringaspecialtoppingoutceremonyJune9,duringwhichthebuildingsfinalsteelbeamwassecuredinplace.Faculty,staffandstudentswereinvitedtosignthebeambeforeitwasliftedtothetopofthestructure.TheceremonyalsofeaturedtheannouncementofseveralothermajorgiftstosupportboththeresearchbuildingandresearchattheSchoolofMedicine:30 million for construction. The announcement was made during a special topping-out ceremony June 9, dur-ing which the building’s final steel beam was secured in place. Faculty, staff and students were invited to sign the beam before it was lifted to the top of the structure. The ceremony also featured the announce-ment of several other major gifts to support both the research building and research at the School of Medicine: • 2 million to establish the James B. and Joan C. Peter Endowed Chair in Biochemistry and Molecular Biology. Dr. James B. Peter (Med ’58) is founder and former chief execu-tive officer of Specialty Laboratories, a hospi-tal- focused clinical reference laboratory. • 2 million to establish the Badeeh A. and Catherine V. Bander Endowed Chair in Ne-phrology. Dr. Steven J. Bander (A&S ’75), adjunct faculty member in nephrology, and his wife, Patricia, are endowing the chair in honor of his parents. • 1.5 million in a challenge grant from the J.E. and L.E. Mabee Foundation to sup-port construction of the research building. The building is expected to open in fall 2007. For more details, visit researchbuild-ing. slu.edu. Research building gets name and 30 million gift For the third consecutive year, U.S.News & World Report has named the Saint Louis University School of Law’s health law program the best in the na-tion. Since the rankings for the health law specialty began a decade ago, Saint Louis University’s Center for Health Law Studies never has been out of the top three. Overall, the magazine’s “Best Graduate Schools 2007” issue ranked the law school among the nation’s 180 accredited law schools. The School of Medicine was ranked No. 62 among the nation’s 144 research-intensive medical schools surveyed by U.S. News. The school’s geriatrics program was ranked 12th in the United States. In addition, the part-time MBA program in the John Cook School of Business was ranked No. 25 in the nation out of 347 part-time MBA programs accredited by the As-sociation to Advance Collegiate Schools of Business (AACSB). Graduate programs honored by U.S. News again Annual Atlas Week recognizes the University’s world view Through more than 50 special events, including discussions, open houses and student presentations, Atlas Week 2006 gave the Saint Louis University community the opportunity to ex-plore the international dimension of SLU’s academic programs and celebrate the University’s role in international education and service. The theme of this year’s Atlas Week, held in April, was “Political and Social Justice in a Global World.” The Signature Symposium featured Nobel Peace laureate Jody Williams, who led the passage of the international treaty banning antipersonnel landmines. Another highlight was a panel discussion commemorating the first anniver-sary of the death of Pope John Paul II. The Billiken World Festival, which featured a Parade of Nations, international cuisine, music, games and informational booths in the quadrangle, wrapped up the week. In SLU’s residence halls Students living on campus during the 2005-06 school year On-campus rooms Residence halls: Clemens, DeMattias, Fusz, Griesedieck, Marguerite, Notre Dame, Reinert and Walsh Apartment complexes: Grand Forest, the Language Houses, Marchetti East and West, and the Village Apartments 3,346 1,785 84 Severson wins teaching award Dr. John G. Severson Jr., professor of biology, received the 41st an-nual Nancy McNeir Ring Award from Alpha Sigma Nu, the Jesuit honor society. It is SLU’s oldest student-initi-ated teaching award and is named for the University’s first dean of women. Severson joined the faculty in 1971, has served as associate dean of the College of Arts and Sciences and led the Academic Services Center from 1993-2001. He played an in-tegral role in the development of the Pre- Law and Pre-Med Scholars programs, as well as SLU 101 and SLU 301 programs for new students. A view of the Arena facing northwest. A student shows her pride during the Parade of Nations. From left: The Strobles, McNamee and Lowney. Signing the beam before it is raised (from left): Alderman Michael McMillan; AT&T-Missouri vice president Debra Hollingsworth; U.S. Senator Christopher “Kit” Bond; Clayco president and SLU trustee Bob Clark; University President Lawrence Biondi, S.J.; SLU trustee Charles Drury and Shirley Drury, donors to the project. Photo by Kevin Lowder Photo by Clayton Berry Photo by Allison Babka Burney Photo by Allison Babka Burney Lincoln Legacy exhibit coming to SLUMA From Aug. 25-Dec. 17, Samuel Cupples House, in partnership with the Saint Louis University Museum of Art, will present “The Lincoln Legacy: Presidential Years.” The exhibit, which will be in the Judith and Adam Aronson Gallery at SLUMA, showcases the Dr. Bernard Hall Abraham Lincoln Collection of the University of Saint Mary in Leavenworth, Kan. It will feature manuscripts and autographed documents, as well as sig-nificant historical artifacts relating to Lincoln’s presidency. The exhibit is free and open to the public. In conjunction with “The Lincoln Legacy,” the University will be the site of a Civil War re-enactment, the “Camp Jackson Historic Encampment,” during Labor Day weekend, Sept. 1-3. For other programming and updates, visit http://lincoln.slu.edu or call (314) 977-2666. t h e A R T S a t S L U Hand-tinted woodcut of Lincoln (1863). MOCRA welcomes back ‘Silver Clouds’ They’re back! SLU’s Museum of Contemporary Religious Art (MOCRA) announces a final show-ing of its most popular show ever, Andy Warhol’s “Silver Clouds.” First shown at MOCRA in 2001 and 2002, the largest-ever U.S. “Clouds” instal-lation features dozens of silver mylar balloons riding the air currents around MOCRA’s capa-cious nave gallery. Visitors are invited to enter into a childlike world of wonder and experience one of Warhol’s groundbreaking experiments with creating unique, non-traditional environ-ments. MOCRA also will be showing a number of Warhol’s “Sunset” prints. The “Clouds” open in mid-September and continue through the fall semester. Call MOCRA at (314) 977-7170 or visit mocra.slu.edu for more information. “Silver Clouds” fill the gallery during the 2002 MOCRA showing. New administrators join SLU As of July 1, Dr. Kent Porterfield is Saint Louis University’s new vice president for student development. Porterfield comes to SLU from Northwest Missouri State Univer-sity, where he was vice president for student affairs — a role he held for nearly a decade. At SLU, Porterfield fosters student formation through non-academic areas, including residence life, student life, student health and counseling, campus recreation and community outreach. He also oversees contracted services such as the bookstore and dining services. At Northwest, Porterfield led many of these same areas and worked to enhance students’ lives. Dr. Connie Evashwick, previously an endowed chair and director of the Center for Health Care In-novation at California State University, Long Beach, joined SLU as dean of the Saint Louis University School of Public Health on July 1. Over the years, she has combined her academic career with consulting and direct operations management. Evashwick has served as vice president of long-term care for two major health care systems and is a national consultant to health systems, hospitals and long-term care organizations. She is the author or editor of 12 books and more than 100 other publications. News Briefs Saint Louis University again opened its doors to the area’s homeless population to provide a hot meal and clothing. During SLU’s annual “Open Doors” event March 23, hundreds of homeless individuals also received free employment and housing assistance, legal services and opportunities to pursue literacy education. SLU President Lawrence Biondi, S.J., and Dr. Ellen Harshman (Grad ’78, Law ’92), dean of the John Cook School of Business, were named to the St. Louis Business Journal’s “Influentials” list this spring. The list recognizes area business and community leaders who make a difference to the region. Biondi was honored as one of 10 “legends” — individuals “who have gone beyond being influential to become legends in our region and beyond.” Dr. Bruce R. Bacon, professor of internal medicine and director of the division of gastroenterology and hepatology at the School of Medicine, has been appointed to the National Commission on Digestive Diseases, an institute of the National Institutes of Health and the National Institute of Diabetes and Digestive Diseases. The commission, comprising 16 people, is charged with conducting an overview of research in digestive diseases and developing a strategic plan for the next 10 years of NIH digestive disease research. Saint Louis University Provost Dr. Joe Weixlmann was named “Distinguished Editor of the Year” by the Council of Editors of Learned Journals. The award recognizes Weixlmann’s dedication and excellence in his work with African American Review, the official publication of the Modern Language Association’s Division on Black American Literature and Culture. He was editor in chief from 1976-2004. The St. Louis Jesuits, sometimes called “the fathers of contemporary American liturgical music,” received an honorary doctorate of music from Creighton University this spring. Roc O’Connor S.J. (A&S ’73), Bob Dufford S.J. (A&S ’67, Grad ’72, ’75), John Foley S.J. (A&S ’68, Grad ’68, ’74), and Dan Schutte (A&S ’72), who were featured in the fall 2005 Universitas, were recognized for their 30 years of ministry to the Church. U N I V E R S I TA S w w w. s l u . e d u U N I V E R S I TA S S UMME R 2 0 0 6 Community service tops 750,000 hours Members of the Saint Louis University community continue to live the institution’s mission as 14,602 students, faculty and staff contributed 753,808 hours of com-munity service and outreach during 2005, according to a recently released University report. This is the second year in a row that members of the University have performed more than 750,000 hours of service. According to the report, more than 1,270 organizations and events benefited from SLU faculty and staff volunteerism, up from 1,110 in 2004. Faculty and staff spent 71,903 hours performing community service in 2005, a drastic jump from 41,533 hours previously. Student service also is intensive. Through academic courses, internships and campus organizations, students committed more than 76,768 hours to outreach. SLU students spend spring break in service During spring break in March more than 50 Saint Louis Uni-versity students participated in rebuilding efforts in New Orleans. Of the group, 39 SLU students assisted Ser-vice International with the demolition of buildings that were flooded or destroyed by Hurricane Katrina. After demolition, the students helped with power washing, sanitizing and rebuilding efforts. Another 15 SLU students worked with Operation Helping Hands, where they helped remove debris in neighborhoods and assisted with light carpentry, as well as construction and restoration of homes and buildings. This year, about 150 SLU students partic-ipated in spring break mission trips not only to New Orleans, but other U.S. locations as well as sites in Mexico and El Salvador. Social justice magazine debuts on campus Current SLU students from various cross-cultural and social justice groups on campus have collaborated to produce a student-led, student-run magazine that aims to raise aware-ness about international social justice issues. Based upon the Jesuit mission, One World focuses attention on men and women around the world who are in dire need of help. Whether it’s poverty and starvation in the developing world or genocide in Sudan, SLU stu-dent writers explore humanitarian issues in an effort to make read-ers realize that they have capacity and responsibility to get involved. To view the magazine online, visit www.sluoneworld.com. Or to order a copy of the 40-page magazine, send your request and 5 contri-bution to: One World c/o Donna Bess; Busch Student Center, Suite 237; 20 N. Grand Blvd.; St. Louis, MO 63103. Make checks payable to Saint Louis University. AHarvard University team recently won the Urban Land Institute Gerald D. Hines Student Urban Design Competition, which was held March 31 at Saint Louis Univ

    Universitas: the magazine of Saint Louis University

    No full text
    Spring/Summer 2003 issue of Universitas: the magazine of Saint Louis UniversityT H E M AG A Z I N E O F S A I N T L O U I S U N I V E R S I T Y S P R I N G / S U M M E R 2 0 0 3 SLU & Midtown By Lawrence Biondi, S.J. Saint Louis University President It’s official: After extensive research and planning, Saint Louis University is moving forward on plans for two excit-ing projects — an arena and a research building. You can read more about the details elsewhere in this issue, but I wanted to share my perspective on these monumental undertakings and what they mean for SLU. Let’s start with the arena. This project has generated much discussion over the years, especially among our Billiken faith-ful. Although SLU has been eager to put the pieces in place for a top-notch athletic facility for some time now, funding proved to be a major obstacle. We also maintained that a new arena should serve much more than our Billiken men’s basketball program. Yes, we envision a 13,000-seat basket-ball venue with a cozy atmosphere, a true college feel and a potentially exhilarating home-court advantage. But with a new arena, we are adding yet another compo-nent to the overall Saint Louis University experience. This project will provide a facility that is easily accessible to our stu-dents for commencement ceremonies and other special engagements, thereby becoming a multipurpose events center. (For more details, see page 13.) We plan to construct our new facility near the Grand Center arts and entertain-ment district. As we strive to strengthen our community, a new arena will be yet another beacon for Midtown. We remain committed to creating a true “college town” atmosphere with shops, restaurants and entertainment, ultimately making Midtown a place where people go to live, to socialize and to learn. Of course, there are direct benefits for our athletic pro-grams. A new arena will allow us to avoid scheduling conflicts at Savvis Center, the current home of our men’s basketball team, and will help us in recruiting student-athletes. Finally, we believe a new arena will better cater to our fans — even those not living on campus. We came to this con-clusion thanks to a marketing study, which also indicated that once built, an arena could provide the University with new sources of revenue from premium seating, advertising and sponsorship. This revenue would allow us to operate the building without drawing on SLU tuition dollars or dipping into our endowment. This “budget neutral” concept for the arena project also is providing a model for our other major endeavor, a research building. Candidly, as excited as I am about the arena, my first and foremost priority is the research building. The need for a dedicated research facility has become a necessity as external funding for SLU research has expanded significantly and successfully during the past decade. The ini-tiative for a new research building at our Health Sciences Center is part of an overall 80 million investment in new and renovated research space that will represent the largest single building project since the University’s founding in 1818. (For more details, see page 2.) The new research building will provide state-of-the-art facilities for health sciences research that directly touches lives while providing additional services to the community. The facility will allow for the consolidation of laboratories scat-tered in different locations at the Health Sciences Center. This unification will strengthen the thematic areas of research through collaborative interactions. In addi-tion, the new research building will aid in the retention of experienced biomedical investigators, assist department chairpersons in recruiting outstanding faculty researchers and enhance the development of new research and degree programs. The building also will expand the University’s research efforts and strengthen our ability to compete for important exter-nal funding. This, in turn, would increase the prestige of Saint Louis University as a major research center and aid in the recruitment of students. Pursuit of truth and scholarly inquiry into new and better understandings of our world have been part of the Ignatian tradi-tion for hundreds of years. Research is an integral part of our mission, a strong com-ponent of our faculty endeavors and an unparalleled educational tool for our students. As we move forward on this important initiative, I look forward to the future benefits we will reap from this important investment in research. I would like to extend my gratitude to all of those people involved in both projects and invite everyone in our Saint Louis University community to spread the word about these two important developments. It is an exciting time to be part of our Saint Louis University family as our destiny of becom-ing the finest Catholic university in the nation continues to take shape. UNIVERSITAS Volume 29, No. 2 Editor Laura Geiser (A&S ’90, Grad ’92) Assistant Editor Chris Waldvogel Intern Billy Brennan Contributors Marie Dilg (Soc Ser ’94) Katie Hanson (A&S ’02) Matt Shaw Bob Woodruff Photo Credits David Altman, 6 Bill Barrett, 7 Steve Dolan, 25 Kevin Lowder, 4, 14-17, 20-21 Kristen Peterson, 3 John Vieth, 9, 11, 12 James Visser, cover, 9, 10 Design AKA Design Inc. Art Direction: Richie Murphy Design: Stacy Lanier UNIVERSITAS is published quarterly by Saint Louis University. Opinions expressed in UNIVERSITAS are those of the individual authors and not neces-sarily those of the University adminis-tration. Unsolicited manuscripts and photographs are welcome but will be returned only if accompanied by a stamped, self-addressed envelope. Letters to the editor must be signed, and letters not intended for publica-tion should indicate that fact. The editor reserves the right to edit all items. Please address all mail to UNIVERSITAS, DuBourg Hall 39, 221 N. Grand, St. Louis, MO 63103. We accept e-mail at [email protected] and fax submissions at (314) 977-2249. Address fax submissions to Editor, UNIVERSITAS. Postmaster: Send address changes to UNIVERSITAS, Saint Louis University, 221 N. Grand Blvd., St. Louis, MO 63103. World Wide Web address: www.slu.edu/pr/universitas.html UNIVERSITAS is printed by Universal Printing Co. and mailed by Accurate Business Mailers Inc. Worldwide circulation: 109,325 © 2003, Saint Louis University. All rights reserved. On the Cover: The Continental Life Building. Its renovation is a sign of the resurgence of SLU’s neighborhood. For more on Midtown St. Louis, see page 8. IIN MEMORIIAM AALLUUMMNNII nnootteess 2 23 32 28 30 SPRING/summer 2003 8 A Grand Plan Saint Louis University’s neighborhood is undergoing a Renaissance. 14 Jesuit Treasures Take a peek at the newest exhibit at the Saint Louis University Museum of Art. 18 Are You What You Eat? SLU nutritionists share their tips for healthy living. C O N T E N T S 2 Research building slated for Health Sciences Center Saint Louis University’s board of trustees has authorized the SLU adminis-tration to proceed with the design and site selection for a new research cen-ter at the Health Sciences Center, part of an 80 million invest-ment in new and reno-vated research space. This is the largest single build-ing project since the University’s found-ing in 1818. Last spring, University President Lawrence Biondi, S.J., identified the new research center as his top pri-ority. The building has been in the planning stages for sev-eral years. Dr. Joseph Weixlmann, who as provost is the University’s chief academic officer, said SLU has several areas of emphasis on its research agenda, including biodefense, infectious dis-eases, virology, cardiovascu-lar, cancer and liver disease. “This initiative is critical to our success in attracting top-notch researchers and to compete for external fund-ing,” Weixlmann said. “The new structure will contain basic and clinical science research in focused areas.” The University has identi-fied several possible sites for the building. Details will be announced in the coming months. Bonds will be issued to finance construction of the center. In addition, raising money for the building is part of the University’s 300 mil-lion “Campaign for Saint Weixlmann named provost Saint Louis University has a new provost, but the per-son assuming the post is not new to the job. Dr. Joseph Weixlmann — who served as interim provost since replac-ing Dr. Sandra Johnson in May 2002 — has been named Louis University: Where Knowledge Touches Lives.” “An opportunity exists for a donor to make a major gift and name the building,” said Don Whelan, vice president for development and University relations. “We are actively pursuing this.” or edited five books and pub-lished 50 articles and book chapters, mostly on American and African-American literary topics. He earned a master’s degree and doctorate from Kansas State University. A committee has been formed to begin the search process for a new dean of the College of Arts and Sciences, Weixlmann’s previous posi-tion. Mike May, S.J., (A&S ’81) has served as interim dean of the college since last June. The chairman of the department of mathematics and mathematical computer science, May is expected to continue in his role as interim dean through the upcoming academic year. provost. The appointment follows a nationwide search. Weixlmann was appointed dean of SLU’s College of Arts and Sciences in March 2001. Prior to that appointment, he was dean of the College of Arts and Sciences at Indiana State University. As provost, Weixlmann is the University’s chief acade-mic officer and also oversees information technology and student development. “Very few universities evidence the depth of commitment to learning, research and service outreach that can be seen today at Saint Louis University,” Weixlmann said. “I am extremely pleased to assume a key leadership role in moving forward the exceptional team of faculty, students, administrators, staff, alumni and friends working collaboratively to make SLU America’s finest Catholic uni-versity, and indeed, America’s finest university, period.” Weixlmann’s familiarity with Jesuit education began at an early age. He attended a Jesuit high school and col-lege, Canisius High School and Canisius College, both in Buffalo, N.Y. He has written Weixlmann CENTER OF ATTENTION: Progress continues on the renovation and expansion of Busch Student Center, which is scheduled to open in early August. The architectural rendering pic-tured above shows what the finished building will look like from Grand Boulevard. The project includes 51,000 square feet of new construction and 100,500 square feet of renovation. NEWS BRIEFS By The Numbers 214 SLU students who studied abroad during the 2002-03 acad-emic year in countries such as Spain, France, the Netherlands, Belgium, El Salvador, Australia, Ireland, Italy, Pakistan, Poland and England. 7,874 Parking spaces at SLU, 2,727 of which are at the Health Sciences Center. 29,952 Pieces of candy stuffed into 7,484 Easter eggs hidden at SLU for the annual alumni Easter Egg Hunt. In all, 926 children attended the April 19 event. 30,671 Meals prepared by SLU’s Campus Kitchen from October 2001 through April 2003. SLU volunteers cook and deliver meals to those in need in the St. Louis area. In all, 22,096 pounds of food have been res-cued/ received from campus din-ing, and 9,730 hours of community service have been completed by those involved. Dr. Paul G. Schmitz (Grad ’66), professor of internal medi-cine- nephrology, received the 2002 Governor’s Award for Excellence in Teaching, which recognizes outstanding faculty members from Missouri colleges and universities and is presented annually to one faculty member from each of the state’s two- and four-year institutions. … Dr. Raymond G. Slavin (Med ’56), director of the division of allergy and immunology at the School of Medicine, received the Fellows Award from the Academy of Science of St. Louis. The award recognizes an active scientist who excels in communicating to col-leagues, future scientists and the general public. A leading spokesman and researcher, Slavin is an expert on allergies and asth-ma. … Dr. Eleonore A. Stump, the Robert J. Henle, S.J., Chair of Philosophy, presented the Gifford Lectures at the University of Aberdeen in Scotland in March. Established as early as 1888, the lectures are among the world’s foremost intellectual events. Past Gifford lecturers include Nobel Prize winners Niels Bohr, John C. Eccles and Albert Schweitzer. … In March, the SLU Women’s Commission celebrated its 30th anniversary with a reception and a presentation that outlined the pre-sent climate for women at SLU. The report was based on a survey of 1,301 women, and results will guide the commission’s activities and programs. New deans named for AHP, Parks The Doisy School of Allied Health Professions and Parks College of Engineering and Aviation soon will be under new leadership. Dr. Charlotte Royeen has accepted appointment as dean for the Doisy School of Allied Health Professions and officially will begin her duties July 1. Royeen will come to SLU from Creighton University, where she has served as associ-ate dean for research in the School of Pharmacy and Allied Health Sciences and was a founding member of Creighton’s Research Council. She holds a doctorate from Virginia Polytechnic Institute and State University and a master’s degree in occupational therapy from Washington University’s School of Medicine. Dr. Bjong Wolf Yeigh will be the dean of Parks College. Yeigh’s appointment also is effective July 1. He joins SLU from Yale University, where he is assistant provost of sci-ence and technology, a post he has held since 1999. Yeigh Sword goes to Joyner-Kersee Saint Louis University has bestowed its highest honor for individual achievement –– the Sword of Ignatius Loyola –– on Olympic champion Jackie Joyner-Kersee. The award was presented to her at the University’s DuBourg Society Recognition Dinner Dec. 8. Joyner-Kersee is often regarded as the best all-around female athlete in the world and the all-time greatest heptath-lete. A native of East St. Louis, Ill., Joyner-Kersee has won several Olympic medals and is noted for her contributions to the community. The Sword of Ignatius Loyola is named for the founder of the Society of Jesus, Inigo Lopez de Loyola. Symbolic of the Ignatian vision of service, the sword is award-ed to those who have given themselves to humankind for the greater glory of God. Arena project OK’d by trustees The Saint Louis University board of trustees has approved the construction of a new SLU arena contingent upon raising an estimated 45 million in private donations. The arena would be built in Midtown St. Louis, where SLU’s campus is located. Michael F. Shanahan Sr. (B&A ’61), chairman and CEO of Engineered Support Systems Inc. and SLU trustee emeritus, is leading the fund-raising effort for the project. For more details, see page 13. Service hours at an all-time high Members of the Saint Louis University com-munity have answered the call to be “women and men for others” as 11,591 people contributed 617,911 hours of service during 2002. The numbers — which were taken from a recently released University report — are up drastically from 2001, when 8,778 participants contributed 489,505 hours of service. The reported number of students participating in community service and volunteerism went up from 4,217 in 2001 to 5,079 in 2002 — an increase of 20 percent. Faculty and staff who responded to the survey also increased 11 percent (from 659 in 2001 to 731 in 2002). From left: Joe Adorjan, chairman of SLU’s board of trustees; Joyner-Kersee; and University President Lawrence Biondi, S.J. received a master’s degree in mechanical engineering from Stanford in 1987 and a doctor-ate in civil engineering and operations research from Princeton in 1995. Dr. Charles Kirkpatrick will step down as dean this July after nine years of service. He will continue his SLU career as a full-time facul-ty member in the department of chemistry. 4 Grad School ranks first in doctorates Saint Louis University’s Graduate School ranks first in number of doctoral degrees granted from Catholic universities for the 2001 academic year, accord-ing to data compiled by the Graduate School and the National Research Council. During that period, the Graduate School granted 105 Ph.D.s and 41 Ed.D.s for a total of 146 doctorates. The Graduate School has ranked among the top five Catholic universities in doctoral degrees granted since 1987, the first year SLU officials began compiling that data. Only Notre Dame joins SLU in that distinction. SLU gets largest research award Protecting babies and a woman’s reproductive health are among the major goals of the largest research award in Saint Louis University’s 185-year history, a $36.8 million NIH contract to combat herpes. SLU will lead a four-year herpes vaccine study involving 7,550 women across the United States for the National Institutes of Health. When herpes is passed from a mother to a child during birth, the disease is life threat-ening for the child and leads to birth defects. “A successful vaccine to fight this disease would represent a major public health triumph,” said Dr. Robert Belshe, the national study chair and Adorjan Professor of Internal Medicine and director of the Center for Vaccine Development at the School of Medicine. “This is the largest clinical trial we’ve organized and has the potential for making a sig-nificant contribution to SLU lab makes cancer discovery Alab headed by a Saint Louis University researcher has made a major breakthrough that could lead to a better mol-ecular understanding of cancer. Results published in the jour-nal Molecular Cell by Dr. Ali Shilatifard and his colleagues show for the first time how a protein known to be involved in the development of cancer functions in normal cells. “This opens the door for further Information initiative launched Aproject under way at Saint Louis University will rev-olutionize, enhance and expand the delivery of infor-mation to students, faculty, staff and alumni. Called “Gateway: the information ini-tiative of Saint Louis University,” the project will plug SLU computer users into significant facts, figures and data. Making use of recently purchased computer hardware and software, Gateway will integrate information from both the administrative and academic aspects of the University and reformulate the way information is cataloged and stored. Student records, financial aid, alumni databases, University financial data and human resources information all will move over to the new system. The shift will take approximately 36 months for the entire University. GLAD GRADS: Approximately 1,800 students graduat-ed from Saint Louis University during annual commence-ment exercises May 17 at Savvis Center. The graduating class is larger than those in recent years. Last year, 1,508 students graduated from SLU. Pictured above with this year’s commencement speaker Bill McClellan (left), a St. Louis Post-Dispatch columnist, are (from left) honorary degree recipients Frank Reale, S.J., (A&S ’74) provincial of the Jesuits of the Missouri Province; Martin L. Mathews, co-founder of St. Louis’ Mathews-Dickey Boys’ and Girls’ Club; and Emily Rauh Pulitzer, founder and president of the Pulitzer Foundation for the Arts. study of this protein in the reg-ulation of gene expression,” said Shilatifard, an associate professor of biochemistry and molecular biology. “Once we understand the normal, we will have a better understanding of where something is going wrong.” This, in turn, could lead to ways to block the path-way and ultimately could stop cancer development, he said. Also participating in this research was the lab of Dr. Mark Johnston at Washington University School of Medicine. women’s health,” he said. The study will be conducted at 16 U.S. locations, with Saint Louis University as the nation-al coordinating site. SLU’s Vaccine Center will enroll approximately 500 people. Check out smoke-free dining online Smoking in restaurants is still legal in St. Louis, but that doesn’t mean it’s pleasant. The School of Public Health recently assembled a list of 100 percent smoke-free restaurants in the St. Louis metro area. More than 200 local establish-ments appear on the list, including Bevo Mill, Café Napoli, Lemon Grass and all locations of the St. Louis Bread Co. For a look at the list, visit www.breatheeasymo.org. 25 Nurses prepared for terrorism Nurses who want to learn how to handle the after-math of a terrorist attack began their studies Feb. 3, when the School of Nursing launched a one-of-a-kind certificate program. “Our dis-aster preparedness certificate program is based upon what we learned when we visited Israel to find out how nurses there deal with terrorism,” said Dr. Dotti James (Nurs ’71, Grad Nurs ’74, ’94, ’97), associate professor of nursing. Four SLU educators — two from the School of Nursing and two from the Center for the Study of Bioterrorism and Emerging Infections in the School of Public Health — traveled to the Hadassah Medical Organization in October to see what Israeli health care professionals do after a terror attack. Students working toward SLU’s cer-tificate will participate in 10 sessions. The curriculum is available through distance learning on the Internet and is offered at Saint Louis University. AHP introduces two new degrees Two new degree programs are under way at SLU’s Doisy School of Allied Health Professions. The University has created the first and only five-year degree in the country that blends a bachelor of science in health information management with a master of health administration. The Doisy School and the School of Public Health are offering the joint degree
    corecore