5,199 research outputs found
Jason Bond Family History
Jason Bond authored this family history as part of the course requirements for HIST 550/700 Your Family in History offered online in Fall 2017 and was submitted to the Pittsburg State University Digital Commons. Please contact the author directly with any questions or comments: [email protected]
Supplementary data for Coiro, Doyle and Hilton
Data and script used to generate the graph in Figure 4 in Coiro, Doyle and Hilton.data.csv : Pollen data in a tabular formattree.nex: tree for analysisScript.r: R scriptmagallon_tree aperture data.nex : nexus version of the data and tree including only angiosperms.</div
Jason vs GIJOE
Thesis (Master's)--University of Washington, 2019Jason vs GI JOE is partly an exercise in autobiography, an experiment in relational aesthetics, and an interdisciplinary artist project at the intersection of comic books, creative writing and performance art. This comic book, Jason vs. GIJOE, is a postmodern double erasure, based on the comic book GIJOE: Cobra II (Issue 1). The original pictures from the comic book have been removed, and replaced by a series of short narratives, describing autobiographical events from the life of the author: me, Jason. Speech bubbles from the original have been left to comment back over top of the stories, obscuring meaning but creating moments of unplanned dialogue. The comic is a readymade, twice erased: once to replace the drawings of the initial comic, and again when using the original dialogue bubbles to speak back to the narrative
Oral history interview with Jason Poudrier
Jason Poudrier, author, discusses growing up in a military family and living in Alaska, North Dakota, Oregon, and finally Oklahoma. He describes what it was like enlisting in the Army after high school in 2001 and how his military service affected him. A recipient of the Purple Heart, he shares his experiences getting injured by shrapnel in Iraq. He later talks about how he uses poetry and writing to cope with his memories of war, and how he hopes to help others do the same.The Deep Roots: Oklahoma Authors Collection is a series of interviews with authors who discuss their lives, work, and creative processes
Lynn Brunelle and Jason Chin: Cook Prize 2025, Gold Medal Acceptance Speech
Author Lynn Brunelle and illustrator Jason Chin give an acceptance speech for Life After Whale: The Amazing Ecosystem of a Whale Fall (Neal Porter Books/Holiday House)https://educate.bankstreet.edu/cook/1016/thumbnail.jp
The people behind the papers – Jason Ko and Daniel Lobo
Planarians grow when they are fed and shrink during periods of starvation. However, it is unclear how they maintain appropriate body proportions as their size changes. A new paper in Development investigates the differences between growth and shrinkage dynamics and builds a mathematical model to explore the mechanisms underpinning these two processes. To learn more about the story behind the paper, we caught up with first author, Jason Ko, and corresponding author, Daniel Lobo, Associate Professor at the University of Maryland.https://doi.org/10.1242/dev.20298
Ep. #085 - Jason W. Moore
This recording and transcript form part of a collection of podcasts conducted by the Cultures of Energy at Rice University. Cultures of Energy brings writers, artists and scholars together to talk, think and feel their way into the Anthropocene. We cover serious issues like climate change, species extinction and energy transition. But we also try to confront seemingly huge and insurmountable problems with insight, creativity and laughter.Cymene and Dominic talk capital and Vanilla Isis and then (11:21) we welcome to the podcast the one and only Jason W. Moore from Binghamton University, author of Capitalism in the Web of Life (Verso, 2015) and Anthropocene or Capitalocene? (PM Press, 2016). We chat with Jason about his most recent work, co-authored with Raj Patel, A History of the World in Seven Cheap Things (U California Press, 2017), forthcoming this October. We talk about why he wanted to write a book for a broader audience, the problems with the “anthropocene” concept in the human sciences, how “capitalocene” can improve our thinking about world history, and how we can avoid vulgar materialism in critical environmental research and activism today. We cover the role that states and agriculture have played in shaping modern capitalism and Jason calls for a seriously engaged pluralism to tackle the urgent challenges of our era. We discuss the cheapening or thingification of life, capitalism as a gravitational field, the importance of frontiers, the violence of the Great Domestication, and why if green energy remains in the mode of “cheap fuel” nothing will change about capitalist accumulation. Jason explains why racial and gender domination are so often lacunae in critiques of petromodernity. Finally we ruminate on how to unmake the capitalist world-ecology and the key principles of the “reparation ecology” that Jason and his colleagues are calling for. Tired of the debate within the left about whether to prioritize jobs or the environment? Then you’ll want to listen on
Cupiennin 1a, an antimicrobial peptide from the venom of the neotropical wandering spider Cupiennius salei, also inhibits the formation of nitric oxide by neuronal nitric oxide synthase
The definitive version is available at www.blackwell-synergy.comCupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC50 concentration of 1.3 ± 0.3 µm. This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15N-labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry.Tara L. Pukala, Jason R. Doyle, Lyndon E. Llewellyn, Lucia Kuhn-Nentwig, Margit A. Apponyi, Frances Separovic and John H. Bowi
NPS Concludes Sleep Study aboard Jason Dunham
http://www.navy.mil/submit/display.asp?story_id=71230Article author is Mass Communication Specialist 2nd Class Deven King, USS Jason Dunham Public AffairsUSS JASON DUNHAM, At Sea (NNS) -- Sailors aboard guided-missile destroyer USS Jason Dunham
(DDG 109) concluded their participation in a two-week sleep study, Dec. 17.
The study was conducted by personnel from the Naval Postgraduate School (NPS) who came
aboard Jason Dunham to interview crewmembers about their watch rotations and monitor their
sleep patterns, activity periods and reaction times
- …
